Wnt-5a Antibody (3A4) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
WNT5A (AAH64694, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV |
| Specificity |
Reacts with wingless-type MMTV integration site family, member 5A. |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
WNT5A |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Paraffin
|
| Application Notes |
This antibody is reactive against recombinant protein in ELISA. |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Wnt-5a Antibody (3A4) - Azide and BSA Free
Background
The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 98%, 98% and 87% amino acid identity to the mouse, rat and the xenopus Wnt5A protein, respectively. The experiments performed in Xenopus laevis embryos identified that human frizzled-5 (hFz5) is the receptor for the Wnt5A ligand and the Wnt5A/hFz5 signaling mediates axis induction. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: BA, BA
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: BA
Species: Hu, Rt
Applications: ICC/IF, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA, BA
Species: Hu
Applications: BA
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu
Applications: ELISA, IHC
Publications for Wnt-5a Antibody (H00007474-M04)(4)
Showing Publications 1 -
4 of 4.
| Publications using H00007474-M04 |
Applications |
Species |
| CS Thomson, J Pundavela, MR Perrino, RA Coover, K Choi, KE Chaney, TA Rizvi, DA Largaespad, N Ratner WNT5A inhibition alters the malignant peripheral nerve sheath tumor microenvironment and enhances tumor growth Oncogene, 2021-06-02;40(24):4229-4241. 2021-06-02 [PMID: 34079083] |
|
|
| Prgomet Z, Andersson T, Lindberg P. Higher expression of WNT5A protein in oral squamous cell carcinoma compared with dysplasia and oral mucosa with a normal appearance. Eur J Oral Sci 2017-06-12 [PMID: 28603941] |
|
|
| Z Prgomet, T Andersson, P Lindberg Optimization, validation, and identification of two reliable antibodies for immunodetection of WNT5A Biotech Histochem, 2017-02-03;0(0):1-13. 2017-02-03 [PMID: 28157427] |
|
|
| Thiele S, Gobel A, Rachner TD et al. WNT5A has Anti-Prostate Cancer Effects In Vitro and Reduces Tumor Growth in the Skeleton In Vivo. J Bone Miner Res. 2014-09-15 [PMID: 25224731] |
|
|
Reviews for Wnt-5a Antibody (H00007474-M04) (0)
There are no reviews for Wnt-5a Antibody (H00007474-M04).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Wnt-5a Antibody (H00007474-M04) (0)