Wnt-2 Antibody - BSA Free

Western Blot: Wnt-2 Antibody [NBP1-57938] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Wnt-2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to WNT2(wingless-type MMTV integration site family member 2) The peptide sequence was selected from the middle region of WNT2. Peptide sequence GSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNR. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WNT2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 38 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Wnt-2 Antibody - BSA Free

• INT1L1
• INT1L1secreted growth factor
• Int-1-like protein 1
• Int-1-related protein
• IRP
• IRPprotein Wnt-2
• wingless-type MMTV integration site family member 2
• Wnt2
• Wnt-2

Background

WNT2 is the ligand for members of the frizzled family of seven transmembrane receptors. WNT2 is a probable developmental protein. WNT2 may be a signaling molecule which affects the development of discrete regions of tissues. WNT2 is likely to signal over only few cell diameters.The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family, and is expressed in the thalamus. It encodes a protein which shows 96% amino acid identity to the mouse Wnt2 protein. Based on the map location of this gene in the 7q31 region, and the phenotype of the diminished social interaction in the knockout mouse, this gene is suggested as a strong candidate gene for autism, a prototypical pervasive development disorder. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: WNT2
• Uniprot:
  • P09544()