WIPI2 Antibody

Images

 
Western Blot: WIPI2 Antibody [NBP2-86383] - Host: Rabbit. Target Name: WIPI2. Sample Tissue: Human HepG2 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WIPI2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human WIPI2. Peptide sequence: ASQSGEAGAGQLLFANFNQDNTEVKGASRAAGLGRRAVVWSLAVGSKSGY The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
WIPI2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WIPI2 Antibody

  • ATG18B
  • Atg21
  • CGI-50
  • DKFZP434J154
  • DKFZp686P02188
  • FLJ12979
  • FLJ14217
  • FLJ42984
  • WD repeat domain phosphoinositide-interacting protein 2
  • WD repeat domain, phosphoinositide interacting 2
  • WD40 repeat protein interacting with phosphoinositides 2
  • WIPI-2
  • WIPI49-like protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88878
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB110-56893
Species: Hu, Mu, Rt, Bv, Ch, Dr, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-82090
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84267
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Dr, Fi, Gp, Pm, Xp, Ze
Applications: WB, Simple Western, EM, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, PLA, RIA, KD, KO
NBP1-55202
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24738
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
MAB6608
Species: Hu, Mu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
NBP1-47842
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P, IP
NBP2-15501
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB110-87320
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, KD
NBP2-61690
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-04611
Species: Hu
AF1049
Species: Hu
Applications: WB, IHC
NBP1-84541
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-86383
Species: Hu
Applications: WB

Publications for WIPI2 Antibody (NBP2-86383) (0)

There are no publications for WIPI2 Antibody (NBP2-86383).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WIPI2 Antibody (NBP2-86383) (0)

There are no reviews for WIPI2 Antibody (NBP2-86383). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WIPI2 Antibody (NBP2-86383) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional WIPI2 Products

Bioinformatics Tool for WIPI2 Antibody (NBP2-86383)

Discover related pathways, diseases and genes to WIPI2 Antibody (NBP2-86383). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WIPI2 Antibody (NBP2-86383)

Discover more about diseases related to WIPI2 Antibody (NBP2-86383).
 

Pathways for WIPI2 Antibody (NBP2-86383)

View related products by pathway.

PTMs for WIPI2 Antibody (NBP2-86383)

Learn more about PTMs related to WIPI2 Antibody (NBP2-86383).

Blogs on WIPI2

There are no specific blogs for WIPI2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WIPI2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WIPI2