WFDC1 Antibody - Azide and BSA Free

Western Blot: WFDC1 Antibody [NBP3-15532] - Western blot analysis of extracts of various cell lines, using WFDC1 Rabbit pAb (NBP3-15532) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunocytochemistry/ Immunofluorescence: WFDC1 Antibody - Azide and BSA Free [NBP3-15532] - Immunofluorescence analysis of L929 cells using WFDC1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

WFDC1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit WFDC1 Antibody - Azide and BSA Free (NBP3-15532) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 111-220 of human WFDC1 (NP_067020.2). PPVLDWLVQPKPRWLGGNGWLLDGPEEVLQAEACSTTEDGAEPLLCPSGYECHILSPGDVAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHFQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WFDC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for WFDC1 Antibody - Azide and BSA Free

• ps20 growth inhibitor
• PS20Prostate stromal protein ps20
• WAP four-disulfide core domain 1 homolog
• WAP four-disulfide core domain 1
• WAP four-disulfide core domain protein 1

Background

WFDC1 encodes a member of the WAP-type four disulfide core domain family. The WAP-type four-disulfide core domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. The encoded protein shares 81% amino acid identity with the rat ps20 protein, which was originally identified as a secreted growth inhibitor. This gene is mapped to chromosome 16q24, an area of frequent loss of heterozygosity in cancers, including prostate, breast and hepatocellular cancers and Wilms' tumor. Owing to its location and a possible growth inhibitory property of its gene product, this gene is suggested to be a tumor suppressor gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: WFDC1