WFDC1 Antibody - BSA Free

Immunohistochemistry-Paraffin: WFDC1 Antibody [NBP1-87207] - Staining of human duodenum shows strong granular positivity in glandular cells.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

WFDC1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit WFDC1 Antibody - BSA Free (NBP1-87207) is a polyclonal antibody validated for use in IHC, WB and ELISA. Anti-WFDC1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LLCPSGYECHILSPGDVAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHFQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WFDC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Reported in scientific literature (PMID: 24934811)
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot Reported in scientific literature (PMID: 24934811)
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  WFDC1 Protein (NBP1-87207PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (81%). Mouse reactivity reported in scientific literature (PMID: 24934811).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for WFDC1 Antibody - BSA Free

• ps20 growth inhibitor
• PS20Prostate stromal protein ps20
• WAP four-disulfide core domain 1 homolog
• WAP four-disulfide core domain 1
• WAP four-disulfide core domain protein 1

Background

WFDC1 encodes a member of the WAP-type four disulfide core domain family. The WAP-type four-disulfide core domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. The encoded protein shares 81% amino acid identity with the rat ps20 protein, which was originally identified as a secreted growth inhibitor. This gene is mapped to chromosome 16q24, an area of frequent loss of heterozygosity in cancers, including prostate, breast and hepatocellular cancers and Wilms' tumor. Owing to its location and a possible growth inhibitory property of its gene product, this gene is suggested to be a tumor suppressor gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for WFDC1 Antibody (NBP1-87207)(1)

Publication using NBP1-87207

• Wilson BJ, Saab KR, Ma J et al. ABCB5 maintains melanoma-initiating cells through a pro-inflammatory cytokine signaling circuit. Cancer Res 2014-08-01 [PMID: 24934811] (ELISA, WB, Mouse, Human)

Bioinformatics

• Gene Symbol: WFDC1