WDR9 Antibody - Azide and BSA Free

Western Blot: WDR9 Antibody [H00054014-B01P] - Analysis of BRWD1 expression in transfected 293T cell line by BRWD1 polyclonal antibody. Lane1:BRWD1 transfected lysate(13.2 KDa). Lane2:Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: WDR9 Antibody [H00054014-B01P] - Analysis of purified antibody to BRWD1 on HeLa cell. (antibody concentration 10 ug/ml)

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

WDR9 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse WDR9 Antibody - Azide and BSA Free (H00054014-B01P) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: BRWD1 (NP_001007247.1, 1 a.a. - 120 a.a.) full-length human protein. MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPKRLDWEGNEHNRSYEELVLSNKHVAPDHLLQICQRIGPMLDKEIPPSISRVTSLLGAGRQSLLRTAKGTLI
• Specificity: Reacts with bromodomain and WD repeat domain containing 1.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: BRWD1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: This antibody is reactive against Isoform D BRWD1 transfected lysate in western blot, immunofluorescence, and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for WDR9 Antibody - Azide and BSA Free

• bromodomain and WD repeat domain containing 1
• bromodomain and WD repeat-containing protein 1
• C21orf107
• chromosome 21 open reading frame 107
• FLJ11315
• FLJ43918
• N143
• transcriptional unit N143
• WD repeat domain 9
• WD repeat protein WDR9-form2
• WD repeat-containing protein 9
• WDR9

Background

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 2 bromodomains and multiple WD repeats, and the function of this protein is not known. This gene is located within the Down syndrome region-2 on chromosome 21. Alternative splicing of this gene generates 3 transcript variants diverging at the 3' ends. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BRWD1
• Entrez:
  • 54014(Human)
• Uniprot:
  • NP_001007247.1(Human)