WDR77 Antibody

Images

 
Immunohistochemistry: WDR77 Antibody [NBP1-82780] - Staining of human fallopian tube shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WDR77 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WDR77
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
WDR77 Protein (NBP1-82780PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WDR77 Antibody

  • Androgen receptor cofactor p44
  • MEP-50
  • MEP50Nbla10071
  • methylosome protein 50
  • MGC2722
  • p44
  • p44/Mep50
  • RP11-552M11.3
  • WD repeat domain 77
  • WD repeat-containing protein 77

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-32482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88792
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP1-91214
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-82780
Species: Hu
Applications: IHC, IHC-P

Publications for WDR77 Antibody (NBP1-82780) (0)

There are no publications for WDR77 Antibody (NBP1-82780).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR77 Antibody (NBP1-82780) (0)

There are no reviews for WDR77 Antibody (NBP1-82780). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for WDR77 Antibody (NBP1-82780) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WDR77 Products

Bioinformatics Tool for WDR77 Antibody (NBP1-82780)

Discover related pathways, diseases and genes to WDR77 Antibody (NBP1-82780). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WDR77 Antibody (NBP1-82780)

Discover more about diseases related to WDR77 Antibody (NBP1-82780).
 

Pathways for WDR77 Antibody (NBP1-82780)

View related products by pathway.

PTMs for WDR77 Antibody (NBP1-82780)

Learn more about PTMs related to WDR77 Antibody (NBP1-82780).
 

Research Areas for WDR77 Antibody (NBP1-82780)

Find related products by research area.

Blogs on WDR77

There are no specific blogs for WDR77, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WDR77 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WDR77