WDR74 Antibody

Images

 
Western Blot: WDR74 Antibody [NBP1-84623] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-637
Immunohistochemistry-Paraffin: WDR74 Antibody [NBP1-84623] - staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WDR74 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GGEGMFRGLAQADGTLITCVDSGILRVWHDKDKDTSSDPLLELRVGPGVCRMRQDPAHPHVVATGGKENALKIWDL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WDR74
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
WDR74 Protein (NBP1-84623PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WDR74 Antibody

  • FLJ10439
  • FLJ21730
  • NOP seven-associated protein 1
  • NSA1
  • WD repeat domain 74
  • WD repeat-containing protein 74

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB8370
Species: Hu
Applications: Flow, CyTOF-ready
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-45490
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB5140
Species: Hu
Applications: IHC
NB600-230
Species: Hu
Applications: WB
MAB8200
Species: Hu, Mu
Applications: IHC
NBP1-81714
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80813
Species: Hu
Applications: IHC, IHC-P
MAB7745
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-85866
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
1827-SF/CF
Species: Hu
NBP2-57453
Species: Hu
Applications: ICC/IF
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-15163
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-23721
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-00513
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84623
Species: Hu
Applications: WB, IHC, IHC-P

Publications for WDR74 Antibody (NBP1-84623) (0)

There are no publications for WDR74 Antibody (NBP1-84623).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR74 Antibody (NBP1-84623) (0)

There are no reviews for WDR74 Antibody (NBP1-84623). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WDR74 Antibody (NBP1-84623) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WDR74 Products

Bioinformatics Tool for WDR74 Antibody (NBP1-84623)

Discover related pathways, diseases and genes to WDR74 Antibody (NBP1-84623). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WDR74 Antibody (NBP1-84623)

Discover more about diseases related to WDR74 Antibody (NBP1-84623).
 

Pathways for WDR74 Antibody (NBP1-84623)

View related products by pathway.

Research Areas for WDR74 Antibody (NBP1-84623)

Find related products by research area.

Blogs on WDR74

There are no specific blogs for WDR74, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WDR74 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WDR74