WDR7 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: WDR7 Antibody [NBP2-14517] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: WDR7 Antibody [NBP2-14517] - Staining of human adrenal gland shows strong cytoplasmic, membranous and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WDR7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AKVQEEEHDLVDDDITTGCLSSVPQMKKISTSYEERRKQATAIVLLGVIG AEFGAEIEPPKLLTRPRSSSQIPEGFGLTSGGSNYSLARHTCKALTFLLL QPPSPKLPPHS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WDR7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
WDR7 Protein (NBP2-14517PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WDR7 Antibody

  • TRAG
  • WDR7 WD repeat domain 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-41371
Species: Hu, Mu, Rt, Ma
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-178
Species: Hu, Mu(-)
Applications: WB, ICC/IF
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NB110-85538
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-92435
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7365
Species: Hu, Mu, Rt
Applications: WB
NBP1-86165
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2781
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-Fr
NB300-619
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
259-HE
Species: Hu
NBP1-84046
Species: Hu
Applications: ICC/IF, IHC, IHC-P
7559-ST
Species: Hu
NBP1-88331
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-88296
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80669
Species: Hu
Applications: IHC, IHC-P
AF4348
Species: Hu, Mu, Rt
Applications: WB, CyTOF-ready, ICC, ICFlow

Publications for WDR7 Antibody (NBP2-14517) (0)

There are no publications for WDR7 Antibody (NBP2-14517).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR7 Antibody (NBP2-14517) (0)

There are no reviews for WDR7 Antibody (NBP2-14517). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for WDR7 Antibody (NBP2-14517) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WDR7 Products

WDR7 NBP2-14517

Bioinformatics Tool for WDR7 Antibody (NBP2-14517)

Discover related pathways, diseases and genes to WDR7 Antibody (NBP2-14517). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WDR7 Antibody (NBP2-14517)

Discover more about diseases related to WDR7 Antibody (NBP2-14517).
 

Pathways for WDR7 Antibody (NBP2-14517)

View related products by pathway.

Blogs on WDR7

There are no specific blogs for WDR7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WDR7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WDR7