| Description | Novus Biologicals Rabbit WDR68 Antibody - BSA Free (NBP1-92590) is a polyclonal antibody validated for use in IHC and WB. Anti-WDR68 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQ |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DCAF7 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Theoretical MW | 39 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-92590 | Applications | Species |
|---|---|---|
| Sircoulomb F, Nicolas N, Ferrari A et al. ZNF703 gene amplification at 8p12 specifies luminal B breast cancer. EMBO Mol Med 2011-03-01 [PMID: 21328542] |
Secondary Antibodies |
Isotype Controls |
Research Areas for WDR68 Antibody (NBP1-92590)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.