WDR68 Antibody - BSA Free

Western Blot: WDR68 Antibody [NBP1-92590] - Analysis in control (vector only transfected HEK293T lysate) and DCAF7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: WDR68 Antibody [NBP1-92590] - Staining of human liver.

Immunohistochemistry-Paraffin: WDR68 Antibody [NBP1-92590] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: WDR68 Antibody [NBP1-92590] - Staining of human cerebral cortex, kidney, liver and testis using Anti-DCAF7 antibody NBP1-92590 (A) shows similar protein distribution across tissues to independent antibody NBP1-92589 (B).

Immunohistochemistry-Paraffin: WDR68 Antibody [NBP1-92590] - Staining of human testis.

Immunohistochemistry-Paraffin: WDR68 Antibody [NBP1-92590] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: WDR68 Antibody [NBP1-92590] - Staining of human kidney.

Staining of human cerebral cortex).

Staining of human liver shows weak cytoplasmic positivity in hepatocytes.

Analysis in control (vector only transfected HEK293T lysate) and DCAF7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.

Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

WDR68 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQ
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DCAF7
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Theoretical MW: 39 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  WDR68 Protein (NBP1-92590PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for WDR68 Antibody - BSA Free

• DDB1 and CUL4 associated factor 7
• DDB1- and CUL4-associated factor 7
• HAN11AN11
• human anthocyanin
• seven-WD-repeat protein of the AN11 family-1
• SWAN-1
• WD repeat domain 68
• WD repeat-containing protein 68
• WD repeat-containing protein An11 homolog
• WDR68
• WD-repeat protein

Background

WDR68 is involved in craniofacial development. Acts upstream of the EDN1 pathway and is required for formation of theupper jaw equivalent, the palatoquadrate. The activity required for EDN1 pathway function differs between the firstand second arches . Associates w

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for WDR68 Antibody (NBP1-92590)(1)

Publication using NBP1-92590

• Sircoulomb F, Nicolas N, Ferrari A et al. ZNF703 gene amplification at 8p12 specifies luminal B breast cancer. EMBO Mol Med 2011-03-01 [PMID: 21328542]

Bioinformatics

• Gene Symbol: DCAF7
• Entrez:
  • 10238(Human)
• Uniprot:
  • P61962(Human)