DYRK4 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: DYRK4 Antibody [NBP1-89511] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.

Staining of human gastrointestinal, kidney, placenta and testis using Anti-DYRK4 antibody NBP1-89511 (A) shows similar protein distribution across tissues to independent antibody NBP2-38781 (B).

Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Analysis in human testis tissue.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DYRK4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DYRK4 Antibody - BSA Free (NBP1-89511) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AELYTGYPLFPGENEVEQLACIMEVLGLPPAGFIQTASRRQTFFDSKGFPKNITNNRGKKRYPDSKDLTMVLKTYDTSFLDFLRRCLVWEP
• Predicted Species: Mouse (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DYRK4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DYRK4 Protein (NBP1-89511PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DYRK4 Antibody - BSA Free

• dual specificity tyrosine-phosphorylation-regulated kinase 4
• dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4
• EC 2.7.12
• EC 2.7.12.1

Background

Dual-specificity kinases, such as DYRK4, play key roles in cell proliferation, survival, and development (Zhang et al., 2005 [PubMed 15607427]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DYRK4