DYRK4 Antibody

Images

 
Western Blot: DYRK4 Antibody [NBP1-89511] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-171
Immunocytochemistry/ Immunofluorescence: DYRK4 Antibody [NBP1-89511] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.
Immunohistochemistry-Paraffin: DYRK4 Antibody [NBP1-89511] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DYRK4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AELYTGYPLFPGENEVEQLACIMEVLGLPPAGFIQTASRRQTFFDSKGFPKNITNNRGKKRYPDSKDLTMVLKTYDTSFLDFLRRCLVWEP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DYRK4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DYRK4 Protein (NBP1-89511PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DYRK4 Antibody

  • dual specificity tyrosine-phosphorylation-regulated kinase 4
  • dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4
  • EC 2.7.12
  • EC 2.7.12.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001859-M01
Species: Hu
Applications: WB, ELISA, IHC, IP
NB110-94452
Species: Hu, Ch, Mu(-), Rt(-)
Applications: WB, ICC/IF
NBP1-33464
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-92589
Species: Hu, Dr
Applications: WB, ICC/IF, IHC, IHC-P
AF5409
Species: Hu, Mu, Rt
Applications: WB
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4914
Species: Hu
Applications: WB
NBP1-77127
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56633
Species: Hu
Applications: WB
AF2940
Species: Hu
Applications: WB, Flow, CyTOF-ready

Publications for DYRK4 Antibody (NBP1-89511) (0)

There are no publications for DYRK4 Antibody (NBP1-89511).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DYRK4 Antibody (NBP1-89511) (0)

There are no reviews for DYRK4 Antibody (NBP1-89511). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DYRK4 Antibody (NBP1-89511) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DYRK4 Products

Bioinformatics Tool for DYRK4 Antibody (NBP1-89511)

Discover related pathways, diseases and genes to DYRK4 Antibody (NBP1-89511). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DYRK4 Antibody (NBP1-89511)

Discover more about diseases related to DYRK4 Antibody (NBP1-89511).
 

Pathways for DYRK4 Antibody (NBP1-89511)

View related products by pathway.

PTMs for DYRK4 Antibody (NBP1-89511)

Learn more about PTMs related to DYRK4 Antibody (NBP1-89511).
 

Research Areas for DYRK4 Antibody (NBP1-89511)

Find related products by research area.

Blogs on DYRK4

There are no specific blogs for DYRK4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DYRK4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DYRK4