WDR19 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: WDR19 Antibody [NBP1-84033] - Staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: WDR19 Antibody [NBP1-84033] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WDR19 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TGADYIVKIFDRHGQKRSEINLPGNCVAMDWDKDGDVLAVIAEKSSCIYLWDANTNKTSQLDNGMRDQMSFLLWSKVGSFLAVGTVKG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WDR19
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
WDR19 Protein (NBP1-84033PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WDR19 Antibody

  • DYF-2
  • FLJ23127
  • IFT144
  • intraflagellar transport 144 homolog
  • KIAA1638Pwdmp
  • ORF26
  • Oseg6
  • PWDMP
  • WD repeat domain 19
  • WD repeat membrane protein PWDMP
  • WD repeat-containing protein 19

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56074
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-84730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32797
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-17406
Species: Hu
NBP2-02313
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-56905
Species: Hu
Applications: WB, ICC/IF
NBP1-92019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-2756
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-16094
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP1-84033
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for WDR19 Antibody (NBP1-84033) (0)

There are no publications for WDR19 Antibody (NBP1-84033).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR19 Antibody (NBP1-84033) (0)

There are no reviews for WDR19 Antibody (NBP1-84033). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for WDR19 Antibody (NBP1-84033) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WDR19 Products

Bioinformatics Tool for WDR19 Antibody (NBP1-84033)

Discover related pathways, diseases and genes to WDR19 Antibody (NBP1-84033). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WDR19 Antibody (NBP1-84033)

Discover more about diseases related to WDR19 Antibody (NBP1-84033).
 

Pathways for WDR19 Antibody (NBP1-84033)

View related products by pathway.

Blogs on WDR19

There are no specific blogs for WDR19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WDR19 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WDR19