Recombinant Human TTC30B Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TTC30B Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 665 of Human TTC30B full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAGLSGAQIPDGEFTAVVYRLIRNARYAEAVQLLGGELQRSPRSRAGLSLLGYCYYRLQEFALAAECYEQLGQLHPELEQYRLYQAQALYKACLYAEATRVAFLLLDNPAYHSRVLHLQAAIKYSEGDLPGSRSLVEQLPSREGGEESGGENETDGQINLGCLLYKEGQYEAACSKFFAALQASGYQPDLSYNLALAYYSSRQYASALKHIAEIIERGIRQHPELGVGMTTEGIDVRSVGNTLVLHQTALVEAFNLKAAIEYQLRNYEAAQEALTDMPPRAEEELDPVTLHNQALMNMDARPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLIYKFLTPYLYDFLDAVITCQTAPEEAFIKLDGLAGMLTEVLRKLTIQVQEARHNRDDEAIKKAVNEYDETMEKYIPVLMAQAKIYWNLENYPMVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKHYDNILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYDDPDKKMYHLCIVNLVIGTLYCAKGNYDFGISRVIKSLEPYNKKLGTDTWYYAKRCFLSLLENMSKHTIMLRDSVIQECVQFLEHCELHGRNIPAVIEQPLEEERMHVGKNTVTYESRQLKALIYEIIGWNI

Protein/Peptide Type
Recombinant Protein
Gene
TTC30B

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TTC30B Protein

  • FLJ30990
  • tetratricopeptide repeat domain 30B
  • tetratricopeptide repeat protein 30B
  • TPR repeat protein 30B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20891
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-02313
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-135
Species: Hu, Mu, Rt, Po, Bv, Fe
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro
NB300-131
Species: Hu, Mu, Rt, Po, Av, Bv, Ma
Applications: WB, ICC/IF, IHC, IHC-P
NB300-133
Species: Hu, Mu, Rt, Po, Av, Bv, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14847
Species: Hu, Pm
Applications: IHC, IHC-P
NBP1-84035
Species: Hu, Mu
Applications: IHC, IHC-P
NBP2-01696
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00284076-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00027130-P02
Species: Hu
NBP1-88691
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84098
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3235
Species: Hu, Mu, Rt
Applications: WB, IHC
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-89910
Species: Hu
Applications: IHC, IHC-P
NB300-137
Species: Hu, Mu, Rt, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for TTC30B Recombinant Protein (H00150737-P01) (0)

There are no publications for TTC30B Recombinant Protein (H00150737-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTC30B Recombinant Protein (H00150737-P01) (0)

There are no reviews for TTC30B Recombinant Protein (H00150737-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TTC30B Recombinant Protein (H00150737-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TTC30B Products

Bioinformatics Tool for TTC30B Recombinant Protein (H00150737-P01)

Discover related pathways, diseases and genes to TTC30B Recombinant Protein (H00150737-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TTC30B Recombinant Protein (H00150737-P01)

Discover more about diseases related to TTC30B Recombinant Protein (H00150737-P01).
 

Pathways for TTC30B Recombinant Protein (H00150737-P01)

View related products by pathway.

Blogs on TTC30B

There are no specific blogs for TTC30B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NF-H Antibody
NB300-135
NF-M Antibody
NB300-133

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TTC30B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TTC30B