IFT43 Antibody

Images

 
Western Blot: IFT43 Antibody [NBP1-92019] - Analysis in control (vector only transfected HEK293T lysate) and IFT43 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: IFT43 Antibody [NBP1-92019] - Staining of human cell line A-431 shows localization to microtubules.
Immunohistochemistry-Paraffin: IFT43 Antibody [NBP1-92019] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IFT43 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EEVQEEDFVLQVAAPPSIQIKRVMTYRDLDNDLMKYSAIQTLDGEIDLKLLTKVLAPEHEVREDDVGWDWDHLFTEVSSEVLTEWDPLQTEKEDPA
Specificity
Specificity of human IFT43 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IFT43
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IFT43 Protein (NBP1-92019PEP)
Publications
Read Publication using NBP1-92019.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IFT43 Antibody

  • chromosome 14 open reading frame 179
  • FLJ32173
  • hypothetical protein LOC112752
  • MGC16028

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KD, KO
NB100-56074
Species: Hu, Mu, Rt, Ma
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-84556
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92581
Species: Hu
Applications: IHC, IHC-P
H00057728-B01P
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF2938
Species: Hu
Applications: WB
NBP1-84975
Species: Hu
Applications: IHC, IHC-P
NB100-56173
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-16925
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-92299
Species: Hu
Applications: WB
NBP1-82884
Species: Hu, Mu
Applications: IHC, IHC-P
NBP1-84463
Species: Hu
Applications: IHC, IHC-P, IP
NBP2-24530
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, Flow-IC
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30999
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for IFT43 Antibody (NBP1-92019)(1)

Reviews for IFT43 Antibody (NBP1-92019) (0)

There are no reviews for IFT43 Antibody (NBP1-92019). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IFT43 Antibody (NBP1-92019) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional IFT43 Products

Bioinformatics Tool for IFT43 Antibody (NBP1-92019)

Discover related pathways, diseases and genes to IFT43 Antibody (NBP1-92019). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFT43 Antibody (NBP1-92019)

Discover more about diseases related to IFT43 Antibody (NBP1-92019).
 

Pathways for IFT43 Antibody (NBP1-92019)

View related products by pathway.

Blogs on IFT43

There are no specific blogs for IFT43, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IFT43 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IFT43