WBP2NL Antibody - BSA Free

Western Blot: WBP2NL Antibody [NBP2-88585] - WB Suggested Anti-WBP2NL Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human Placenta

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

WBP2NL Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit WBP2NL Antibody - BSA Free (NBP2-88585) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human WBP2NL. Peptide sequence: MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGT The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WBP2NL
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for WBP2NL Antibody - BSA Free

• MGC26816
• PAWPFLJ26145
• postacrosomal sheath WW domain-binding protein
• WBP2 N-terminal like
• WW domain-binding protein 2-like

Background

Regulated by GSTP1 and playing a role in cell activation, WBP2NL is a sperm-specific WW domain-binding protein. It promotes meiotic resumption and may play a role in pronuclear formation during oocyte fertilization. Other biological processes involved with WBP2NL include egg activation, female pronucleus assembly and male pronucleus assembly. Mitral valve stenosis, cerebrovascular accident and pulmonary edema are diseases associated with WBP2NL.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: WBP2NL