WARS2 Antibody - Azide and BSA Free

Western Blot: WARS2 Antibody [H00010352-B01P] - Analysis of WARS2 expression in transfected 293T cell line by WARS2 polyclonal antibody. Lane 1: WARS2 transfected lysate(24.2 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

WARS2 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse WARS2 Antibody - Azide and BSA Free (H00010352-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: WARS2 (NP_957715.1, 1 a.a. - 220 a.a.) full-length human protein. MALHSMRKARERWSFIRALHKGSAAAPALQKDSKKRVFSGIQPTGILHLGNYLGAIESWVRLQDEYDSVLYSIVDLHSITVPQDPAVLRQSILDMTAVLLACGINPEKSILFQQSQVSEHTQLSWILSCMVRLPRLQHLHQWKAKTTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQGFNKKYGEFFPVPESILSMCVLVFLT
• Specificity: WARS2 - tryptophanyl tRNA synthetase 2 (mitochondrial),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: WARS2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for WARS2 Antibody - Azide and BSA Free

• (Mt)TrpRS
• EC 6.1.1
• EC 6.1.1.2
• TrpRStryptophan-tRNA ligase
• tryptophan tRNA ligase 2, mitochondrial
• Tryptophan--tRNA ligase
• tryptophanyl tRNA synthetase 2, mitochondrial
• tryptophanyl-tRNA synthetase, mitochondrial

Background

Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. This gene encodes the mitochondrial tryptophanyl-tRNA synthetase. Two alternative transcripts encoding different isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: WARS2
• Entrez:
  • 10352(Human)
• Uniprot:
  • NP_957715.1(Human)