VPS52 Antibody - BSA Free

Western Blot: VPS52 Antibody [NBP1-57628] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

VPS52 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to VPS52 (vacuolar protein sorting 52 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of VPS52)(50ug). Peptide sequence RYWEQVLALLWPRFELILEMNVQSVRSTDPQRLGGLDTRPHYITRRYAEF. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VPS52
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for VPS52 Antibody - BSA Free

• ARE1
• dJ1033B10.5
• DKFZp547I194
• SAC2 suppressor of actin mutations 2-like (yeast)
• SAC2 suppressor of actin mutations 2-like protein
• SAC2
• SACM2LRP5-1033B10
• vacuolar protein sorting 52 (yeast)
• vacuolar protein sorting 52 homolog (S. cerevisiae)
• vacuolar protein sorting-associated protein 52 homolog

Background

This gene encodes a protein that is similar to the yeast suppressor of actin mutations 2 gene. The yeast protein forms a subunit of the tetrameric Golgi-associated retrograde protein complex that is involved in vesicle trafficking from from both early and late endosomes, back to the trans-Golgi network. This gene is located on chromosome 6 in a head-to-head orientation with the gene encoding ribosomal protein S18.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: VPS52
• Uniprot:
  • Q8N1B4(Human)