Recombinant Human VPS4A Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human VPS4A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-437 of Human VPS4A full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPNIRWNDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEVDSLCGSRNENESEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSAIRRRFEKRIYIPLPEEAARAQMFRLHLGSTPHNLTDANIHELARKTEGYSGADISIIVRDSLMQPVRKVQSATHFKKVCGPSRTNPSMMIDDLLTPCSPGDPGAMEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNADDLLKVKKFSEDFGQES

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
VPS4A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
75.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human VPS4A Protein

  • FLJ22197
  • hVPS4
  • Protein SKD2
  • SKD1
  • SKD1A
  • SKD2
  • vacuolar protein sorting 4 homolog A (S. cerevisiae)
  • vacuolar protein sorting 4A (yeast homolog)
  • vacuolar protein sorting factor 4A
  • vacuolar protein sorting-associated protein 4A
  • vacuolar sorting protein 4
  • VPS4-1SKD1-homolog
  • VPS4vacuolar protein sorting 4A (yeast)

Background

The protein encoded by this gene is a member of the AAA protein family (ATPases associated with diverse cellular activities), and is the homolog of the yeast Vps4 protein. In humans, two paralogs of the yeast protein have been identified. The former share a high degree of aa sequence similarity with each other, and also with yeast Vps4 and mouse Skd1 proteins. The mouse Skd1 (suppressor of K+ transport defect 1) has been shown to be really an yeast Vps4 ortholog. Functional studies indicate that both human paralogs associate with the endosomal compartments, and are involved in intracellular protein trafficking, similar to Vps4 protein in yeast. The gene encoding this paralog has been mapped to chromosome 16; the gene for the other resides on chromosome 18. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20881
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90201
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB200-112
Species: Hu, Mu, Rt, Ha, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KO
NBP2-65248
Species: Hu
NBP1-91782
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86745
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-91780
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NBP1-89391
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83726
Species: Hu
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
H00005119-B02P
Species: Hu
Applications: WB, ICC/IF
H00009146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-46283
Species: Hu
Applications: WB, IHC
AF7117
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-92381
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85973
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89490
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for VPS4A Recombinant Protein (H00027183-P01) (0)

There are no publications for VPS4A Recombinant Protein (H00027183-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS4A Recombinant Protein (H00027183-P01) (0)

There are no reviews for VPS4A Recombinant Protein (H00027183-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VPS4A Recombinant Protein (H00027183-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VPS4A Products

Bioinformatics Tool for VPS4A Recombinant Protein (H00027183-P01)

Discover related pathways, diseases and genes to VPS4A Recombinant Protein (H00027183-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VPS4A Recombinant Protein (H00027183-P01)

Discover more about diseases related to VPS4A Recombinant Protein (H00027183-P01).
 

Pathways for VPS4A Recombinant Protein (H00027183-P01)

View related products by pathway.

PTMs for VPS4A Recombinant Protein (H00027183-P01)

Learn more about PTMs related to VPS4A Recombinant Protein (H00027183-P01).
 

Research Areas for VPS4A Recombinant Protein (H00027183-P01)

Find related products by research area.

Blogs on VPS4A

There are no specific blogs for VPS4A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

VPS4A Antibody
NBP1-54618
Alix Antibody
NBP1-90201

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human VPS4A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol VPS4A