Recombinant Human VPS37B Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human VPS37B Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-285 of Human VPS37B full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAGAGSEARFAGLSLVQLNELLEDEGQLTEMVQKMEETQNVQLNKEMTLASNRSLAEGNLLYQPQLDTLKARLTQKYQELQVLFEAYQIKKTKLDRQSSSASLETLLALLQAEGAKIEEDTENMAEKFLDGELPLDSFIDVYQSKRKLAHMRRVKIEKLQEMVLKGQRLPQALAPLPPRLPELAPTAPLPYPAPEASGPPAVAPRRIPPPPPPVPAGRLATPFTAAMSSGQAVPYPGLQCPPLPPRVGLPTQQGFSSQFVSPYPPPLPQRPPPRLPPHQPGFILQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
VPS37B
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human VPS37B Protein

  • ESCRT-I complex subunit VPS37B
  • FLJ12750
  • hVps37B
  • vacuolar protein sorting 37 homolog B (S. cerevisiae)
  • vacuolar protein sorting 37B (yeast)
  • vacuolar protein sorting 37B
  • vacuolar protein sorting-associated protein 37B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-112
Species: Hu, Mu, Rt, Ha, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KO
NBP1-85976
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00009146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-83528
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57242
Species: Hu
Applications: WB, ICC/IF
NBP1-83632
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
AF6567
Species: Hu, Mu
Applications: WB, IHC
NBP1-89490
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006430-B01P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC-P
NBP1-81639
Species: Hu
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-94044
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1397
Species: Hu, Mu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA, ICC
NBP2-57268
Species: Hu
Applications: WB, ICC/IF
NBP2-55104
Species: Hu
Applications: WB, ICC/IF
NBP1-85641
Species: Hu
Applications: IHC, IHC-P
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-93480
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20872
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for VPS37B Recombinant Protein (H00079720-P01) (0)

There are no publications for VPS37B Recombinant Protein (H00079720-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS37B Recombinant Protein (H00079720-P01) (0)

There are no reviews for VPS37B Recombinant Protein (H00079720-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VPS37B Recombinant Protein (H00079720-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VPS37B Products

Bioinformatics Tool for VPS37B Recombinant Protein (H00079720-P01)

Discover related pathways, diseases and genes to VPS37B Recombinant Protein (H00079720-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VPS37B Recombinant Protein (H00079720-P01)

Discover more about diseases related to VPS37B Recombinant Protein (H00079720-P01).
 

Pathways for VPS37B Recombinant Protein (H00079720-P01)

View related products by pathway.

PTMs for VPS37B Recombinant Protein (H00079720-P01)

Learn more about PTMs related to VPS37B Recombinant Protein (H00079720-P01).

Blogs on VPS37B

There are no specific blogs for VPS37B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

VPS37B Antibody
NBP1-82283

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human VPS37B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol VPS37B