VPS13B Antibody

Images

 
Western Blot: VPS13B Antibody [NBP2-55104] - Analysis in human ovary tissue.
Immunocytochemistry/ Immunofluorescence: VPS13B Antibody [NBP2-55104] - Staining of human cell line U-2 OS shows localization to cell junctions. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VPS13B Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PSVIKIHTLVESLKLSITDQQLPMFIRIMQLGIALYYGEIGNFKEGEIEDLTCHNKDMLGNITGSEDETR
Specificity
Specificity of human VPS13B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VPS13B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
VPS13B Recombinant Protein Antigen (NBP2-55104PEP)

Reactivity Notes

Mouse 83%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for VPS13B Antibody

  • cohen syndrome protein 1
  • DKFZp313I0811
  • KIAA0532
  • vacuolar protein sorting 13 homolog B (yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85641
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88606
Species: Hu
Applications: Simple Western, IHC, IHC-P
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
7270-IL/CF
Species: Hu
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88370
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-15253
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-60052
Species: Hu
Applications: WB

Publications for VPS13B Antibody (NBP2-55104) (0)

There are no publications for VPS13B Antibody (NBP2-55104).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS13B Antibody (NBP2-55104) (0)

There are no reviews for VPS13B Antibody (NBP2-55104). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for VPS13B Antibody (NBP2-55104) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional VPS13B Products

Bioinformatics Tool for VPS13B Antibody (NBP2-55104)

Discover related pathways, diseases and genes to VPS13B Antibody (NBP2-55104). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VPS13B Antibody (NBP2-55104)

Discover more about diseases related to VPS13B Antibody (NBP2-55104).
 

Pathways for VPS13B Antibody (NBP2-55104)

View related products by pathway.

Blogs on VPS13B

There are no specific blogs for VPS13B, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VPS13B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VPS13B