VPS35 Antibody

Images

 
Western Blot: VPS35 Antibody [NBP2-13517] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-VPS35 antibody. Remaining relative intensity is presented. Loading ...read more
Immunocytochemistry/ Immunofluorescence: VPS35 Antibody [NBP2-13517] - Staining of human cell line U-2 OS shows localization to endosomes & lysosomes.
Immunohistochemistry-Paraffin: VPS35 Antibody [NBP2-13517] - Staining of human testis shows moderate cytoplasmic and membranous positivity in cells in seminiferous ducts.
Western Blot: VPS35 Antibody [NBP2-13517] - Analysis in human cell line HEK 293.
Western Blot: VPS35 Antibody [NBP2-13517] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: VPS35 Antibody [NBP2-13517] - Staining of human skin shows moderate cytoplasmic positivity in keratinocytes.
Immunohistochemistry-Paraffin: VPS35 Antibody [NBP2-13517] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VPS35 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SCYVLSNVLDYNTEIVSQDQVDSIMNLVSTLIQDQPDQPVEDPDPEDFAD EQSLVGRFIHLLRSEDPDQQYLILNTARKHFGAGGNQRIRFTLPPLVFAA YQLAFRYKENSKVDD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VPS35
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
VPS35 Protein (NBP2-13517PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VPS35 Antibody

  • DKFZp434P1672
  • FLJ10752
  • FLJ13588
  • FLJ20388
  • hVPS35
  • Maternal-embryonic 3
  • MEM3DKFZp434E1211
  • vacuolar protein sorting 35 (yeast homolog)
  • vacuolar protein sorting 35 (yeast)
  • vacuolar protein sorting 35 homolog (S. cerevisiae)
  • vacuolar protein sorting-associated protein 35
  • Vesicle protein sorting 35

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-36754
Species: Hu
Applications: WB, IB, ICC/IF, IHC
NBP1-85288
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, SignalStim
NB100-282
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
AF5699
Species: Hu, Mu
Applications: WB, IHC
NBP1-89485
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
AF3926
Species: Hu, Mu, Rt
Applications: WB
NB300-514
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-26380
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-44235
Species: Ce, Pl
Applications: WB, ELISA, IHC
NB300-268
Species: Hu, Mu, Bv, Ce
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-13361
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57299
Species: Hu
Applications: WB, ICC/IF, IHC-P
H00009146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-268
Species: Hu, Rt, Po
Applications: WB, IP
NBP2-13517
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for VPS35 Antibody (NBP2-13517) (0)

There are no publications for VPS35 Antibody (NBP2-13517).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS35 Antibody (NBP2-13517) (0)

There are no reviews for VPS35 Antibody (NBP2-13517). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for VPS35 Antibody (NBP2-13517) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VPS35 Products

Bioinformatics Tool for VPS35 Antibody (NBP2-13517)

Discover related pathways, diseases and genes to VPS35 Antibody (NBP2-13517). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VPS35 Antibody (NBP2-13517)

Discover more about diseases related to VPS35 Antibody (NBP2-13517).
 

Pathways for VPS35 Antibody (NBP2-13517)

View related products by pathway.

PTMs for VPS35 Antibody (NBP2-13517)

Learn more about PTMs related to VPS35 Antibody (NBP2-13517).
 

Research Areas for VPS35 Antibody (NBP2-13517)

Find related products by research area.

Blogs on VPS35

There are no specific blogs for VPS35, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VPS35 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VPS35