VPREB3 Antibody - BSA Free

Western Blot: VPREB3 Antibody [NBP1-89347] - Analysis in control (vector only transfected HEK293T lysate) and VPREB3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: VPREB3 Antibody [NBP1-89347] - Staining of human lymph node shows strong cytoplasmic positivity in reaction center cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

VPREB3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit VPREB3 Antibody - BSA Free (NBP1-89347) is a polyclonal antibody validated for use in IHC and WB. Anti-VPREB3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYGFSP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VPREB3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  VPREB3 Protein (NBP1-89347PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for VPREB3 Antibody - BSA Free

• N27C7-2
• pre-B lymphocyte 3,8HS20
• pre-B lymphocyte gene 3
• pre-B lymphocyte protein 3
• Protein VPreB3

Background

The VPREB3 gene product is the human homologue of the mouse VpreB3 (8HS20) protein, and is specifically expressed in cell lines representative of all stages of B-cell differentiation. It is also related to VPREB1 and other members of the immunoglobulin supergene family. The VPREB3 protein associates with membrane mu heavy chains early in the course of pre-B cell receptor biosynthesis. The precise function of VPREB3 is not known, but it may contribute to mu chain transport in pre-B cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for VPREB3 Antibody (NBP1-89347)(1)

Publication using NBP1-89347

• Felizola SJ, Katsu K, Ise K et al. Pre-B Lymphocyte Protein 3 (VPREB3) Expression in the Adrenal Cortex: Precedent for non-Immunological Roles in Normal and Neoplastic Human Tissues Endocr. Pathol. 2015-04-10 [PMID: 25861052] (Human)

Bioinformatics

• Gene Symbol: VPREB3