VILIP3 Antibody [HRP]

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: HRP

VILIP3 Antibody [HRP] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human VILIP3 (NP_002140.2).
  
  Sequence:
  MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HPCAL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoprecipitation
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: PBS
• Preservative: No Preservative
• Purity: Affinity purified

Alternate Names for VILIP3 Antibody [HRP]

• BDR1Visinin-like protein 3
• Calcium-binding protein BDR-1
• hippocalcin-like 1
• HLP2hippocalcin-like protein 1
• VILIP-3

Background

VILIP3 is encoded by this gene is a member of neuron-specific calcium-binding proteins family found in the retina and brain. It is highly similar to human hippocalcin protein and nearly identical to the rat and mouse hippocalcin like-1 proteins. It may be involved in the calcium-dependent regulation of rhodopsin phosphorylation and may be of relevance for neuronal signalling in the central nervous system. There are two alternatively spliced transcript variants of this gene, with multiple polyadenylation sites. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HPCAL1