VEZT Antibody

Images

 
Western Blot: VEZT Antibody [NBP1-85040] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver ...read more
Immunocytochemistry/ Immunofluorescence: VEZT Antibody [NBP1-85040] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: VEZT Antibody [NBP1-85040] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VEZT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DELEKLVCTKETQELVSEAYPILEQKLKLIQPHVQASNNCWEEAISQVDKLLRRNTDKKGKPEIACENPHCTVVPLKQPTLHIADKDPIPEEQELEAYVDDIDIDSDFRKDDFYYLSQEDKERQKREHEESKRVLQELKSVLG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VEZT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
VEZT Protein (NBP1-85040PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VEZT Antibody

  • DKFZp761C241
  • vezatin
  • vezatin, adherens junctions transmembrane protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84266
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
594-ML/CF
Species: Mu
596-MR
Species: Mu
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00025861-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-87477
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1234
Species: Hu
Applications: WB, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), ICFlow, ELISA(Sta)
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP1-98293
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NB500-317
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
NBP1-31553
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-85040
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for VEZT Antibody (NBP1-85040) (0)

There are no publications for VEZT Antibody (NBP1-85040).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VEZT Antibody (NBP1-85040) (0)

There are no reviews for VEZT Antibody (NBP1-85040). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for VEZT Antibody (NBP1-85040) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VEZT Products

VEZT NBP1-85040

Bioinformatics Tool for VEZT Antibody (NBP1-85040)

Discover related pathways, diseases and genes to VEZT Antibody (NBP1-85040). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VEZT Antibody (NBP1-85040)

Discover more about diseases related to VEZT Antibody (NBP1-85040).
 

Pathways for VEZT Antibody (NBP1-85040)

View related products by pathway.

PTMs for VEZT Antibody (NBP1-85040)

Learn more about PTMs related to VEZT Antibody (NBP1-85040).

Blogs on VEZT

There are no specific blogs for VEZT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VEZT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VEZT