Recombinant Mouse VEGF 121 Protein

Product Discontinued

Recombinant Mouse VEGF 121 Protein Summary

• Description: Recombinant bioactive protein for Mouse VEGF 121
  
  Source:E. coli
  Amino Acid Sequence:(Q00731) - MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR
  
  This product is manufactured by Abcam and distributed by Novus Biologicals. (Abcam Catalog Number: ab269238)
• Preparation Method: Determined to be >97% pure by SDS-PAGE
• Details of Functionality: The activity as determined by dose-dependent proliferation of human umbilical vein endothelial cells (HUVEC) was typically found to be 1-5 ng/ml.
• Source: E. coli
• Protein/Peptide Type: Recombinant Protein
• Gene: VEGFA
• Purity: >97%, by SDS-PAGE
• Endotoxin Note: <0.1 ng/ug

Applications/Dilutions

• Dilutions:
  • Bioactivity
  • SDS-Page
• Theoretical MW: 28.2 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20 to -80C. Avoid freeze-thaw cycles.
• Buffer: Sterile filtered and lyophilized with no additives
• Concentration: Lyoph
• Purity: >97%, by SDS-PAGE
• Reconstitution Instructions: Reconstitute the lyophilized product with sterile H2O at a concentration of 0.1 - 0.5 mg/ml, which can be further diluted into other aqueous solutions

Alternate Names for Recombinant Mouse VEGF 121 Protein

• MVCD1
• vascular endothelial growth factor A
• Vascular permeability factor
• VEGF-A
• VEGFMGC70609
• VPFvascular endothelial growth factor

Background

Recombinant Mouse VEGF-121 is a truncated version of Mouse VEGF-165. Mouse VEGF-121 is a homodimer with a molecular weight of 28.2 kDa.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: VEGFA