VE-Statin/EGFL7 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: RGDTCQSGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKD |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
EGFL7 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
Recommended conditions for IHC,Retrieval method: HIER pH6 |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for VE-Statin/EGFL7 Antibody - BSA Free
Background
Regulates vascular tubulogenesis in vivo. Inhibits platelet-derived growth factor (PDGF)-BB-induced smooth muscle cell migration and promotes endothelial cells adhesion to the substrate in vitro
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, WB
Species: Hu
Applications: ELISA, IHC, IP, WB
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
Species: Mu
Applications: AdBlk, IHC, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC
Publications for VE-Statin/EGFL7 Antibody (NBP2-68693) (0)
There are no publications for VE-Statin/EGFL7 Antibody (NBP2-68693).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for VE-Statin/EGFL7 Antibody (NBP2-68693) (0)
There are no reviews for VE-Statin/EGFL7 Antibody (NBP2-68693).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for VE-Statin/EGFL7 Antibody (NBP2-68693) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional VE-Statin/EGFL7 Products
Research Areas for VE-Statin/EGFL7 Antibody (NBP2-68693)
Find related products by research area.
|
Blogs on VE-Statin/EGFL7