EGFL8 Antibody


Immunocytochemistry/ Immunofluorescence: EGFL8 Antibody [NBP2-49327] - Staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry: EGFL8 Antibody [NBP2-49327] - Staining of human placenta shows strong membranous and cytoplasmic positivity in decidua cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

EGFL8 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: FNTAGSFTCGCPHDLVLGVDGRTCMEGSPEPPTSASILSVAVREAEKDERALKQEIHELRG
Specificity of human EGFL8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
EGFL8 Recombinant Protein Antigen (NBP2-49327PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for EGFL8 Antibody

  • C6orf8
  • chromosome 6 open reading frame 8
  • EGF-like protein 8
  • EGF-like-domain, multiple 8
  • epidermal growth factor-like protein 8
  • FLJ44493
  • FLJ52513
  • FLJ75166
  • FLJ97375
  • MGC44938
  • MGC59719
  • NG3FLJ78536
  • Vascular endothelial statin-2
  • VE-statin-2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Mu
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for EGFL8 Antibody (NBP2-49327) (0)

There are no publications for EGFL8 Antibody (NBP2-49327).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EGFL8 Antibody (NBP2-49327) (0)

There are no reviews for EGFL8 Antibody (NBP2-49327). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for EGFL8 Antibody (NBP2-49327) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for EGFL8 Antibody (NBP2-49327)

Discover related pathways, diseases and genes to EGFL8 Antibody (NBP2-49327). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EGFL8 Antibody (NBP2-49327)

Discover more about diseases related to EGFL8 Antibody (NBP2-49327).

Pathways for EGFL8 Antibody (NBP2-49327)

View related products by pathway.

Blogs on EGFL8

There are no specific blogs for EGFL8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our EGFL8 Antibody and receive a gift card or discount.


Gene Symbol EGFL8