VAP-1/AOC3 Antibody (4B8)

Images

 
Immunocytochemistry/ Immunofluorescence: VAP-1/AOC3 Antibody (4B8) [H00008639-M06] - Analysis of monoclonal antibody to AOC3 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: VAP-1/AOC3 Antibody (4B8) [H00008639-M06] - Detection limit for recombinant GST tagged AOC3 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, ICC/IF
Clone
4B8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

VAP-1/AOC3 Antibody (4B8) Summary

Immunogen
AOC3 (NP_003725, 351 a.a. - 450 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DVRFQGERLVYEISLQEALAIYGGNSPAAMTTRYVDGGFGMGKYTTPLTRGVDCPYLATYVDWHFLLESQAPKTIRDAFCVFEQNQGLPLRRHHSDLYSH
Specificity
AOC3 - amine oxidase, copper containing 3 (vascular adhesion protein 1) (4B8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AOC3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for VAP-1/AOC3 Antibody (4B8)

  • amine oxidase, copper containing 3 (vascular adhesion protein 1)
  • AOC3
  • Copper amine oxidase
  • EC 1.4.3
  • HPAO
  • HPAOSSAO
  • Semicarbazide-sensitive amine oxidase
  • SSAO
  • VAP1
  • VAP-1
  • VAP1EC 1.4.3.21
  • VAP-1membrane primary amine oxidase
  • Vascular adhesion protein 1

Background

Copper amine oxidases catalyze the oxidative conversion of amines to aldehydes in the presence of copper and quinone cofactor. The product is a major protein on the adipocyte plasma membrane. It has adhesive properties and also has functional monoamine oxidase activity. A pseudogene for this gene has been discribed and is located approximately 9-kb downstream. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01752
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87493
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-58006
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-2527
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
796-IC
Species: Mu
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
NBP1-62442
Species: Hu
Applications: WB
NB100-1642
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-CS
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA

Publications for VAP-1/AOC3 Antibody (H00008639-M06) (0)

There are no publications for VAP-1/AOC3 Antibody (H00008639-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VAP-1/AOC3 Antibody (H00008639-M06) (0)

There are no reviews for VAP-1/AOC3 Antibody (H00008639-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for VAP-1/AOC3 Antibody (H00008639-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VAP-1/AOC3 Products

Bioinformatics Tool for VAP-1/AOC3 Antibody (H00008639-M06)

Discover related pathways, diseases and genes to VAP-1/AOC3 Antibody (H00008639-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VAP-1/AOC3 Antibody (H00008639-M06)

Discover more about diseases related to VAP-1/AOC3 Antibody (H00008639-M06).
 

Pathways for VAP-1/AOC3 Antibody (H00008639-M06)

View related products by pathway.

PTMs for VAP-1/AOC3 Antibody (H00008639-M06)

Learn more about PTMs related to VAP-1/AOC3 Antibody (H00008639-M06).

Blogs on VAP-1/AOC3

There are no specific blogs for VAP-1/AOC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VAP-1/AOC3 Antibody (4B8) and receive a gift card or discount.

Bioinformatics

Gene Symbol AOC3
Entrez
Uniprot