VAMP3/Cellubrevin Antibody [Biotin]

Product Discontinued

VAMP3/Cellubrevin Antibody [Biotin] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human VAMP3/Cellubrevin (NP_004772.1).
  
  Sequence:
  MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VAMP3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: PBS
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Alternate Names for VAMP3/Cellubrevin Antibody [Biotin]

• CEBCellubrevin
• cellubrevin
• SYB3
• Synaptobrevin-3
• VAMP-3
• vesicle-associated membrane protein 3 (cellubrevin)
• vesicle-associated membrane protein 3

Background

The vesicle associated membrane proteins (VAMP) or synaptobrevins are calcium binding proteins specific to eukaryotes. VAMPs, along with synaptosomal associated protein of 25 kDa (SNAP-25) and syntaxin, form the core complex of soluble NSF attachment protein receptor (SNARE) proteins that interact with the soluble proteins N-ethylmaleimide-sensitive factor (NSF) and alpha-SNAP. These membrane associated proteins play a key role in the regulation of vesicle membrane fusion with the plasma membrane. The Clostridium tetani neurotoxin is a metalloprotease with specificity for VAMP. In Alzheimer®s disease, all VAMP isoform levels appear to be significantly reduced.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: VAMP3