USP48 Antibody - BSA Free

Western Blot: USP48 Antibody [NBP1-59752] - HepG2 cell lysate, concentration 2.5 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

USP48 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to USP48(ubiquitin specific peptidase 48) The peptide sequence was selected from the middle region of USP48. Peptide sequence ALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYV. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: USP48
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for USP48 Antibody - BSA Free

• Deubiquitinating enzyme 48
• DKFZp762M1713
• EC 3.1.2.15
• EC 3.4.19.12
• FLJ11328
• FLJ20103
• FLJ23054
• FLJ23277
• MGC132556
• MGC14879
• RAP1GA1
• synUSP
• ubiquitin carboxyl-terminal hydrolase 48
• ubiquitin specific peptidase 48
• ubiquitin specific protease 31
• ubiquitin specific protease 48
• ubiquitin thioesterase 48
• Ubiquitin thiolesterase 48
• Ubiquitin-specific-processing protease 48
• USP31
• USP48

Background

USP48 is a protein containing domains that associate it with the peptidase family C19, also known as family 2 of ubiquitin carboxyl-terminal hydrolases. Family members function as deubiquitinating enzymes, recognizing and hydrolyzing the peptide bond at the C-terminal glycine of ubiquitin. Enzymes in peptidase family C19 are involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: USP48