USP44 Antibody - BSA Free

Western Blot: USP44 Antibody [NBP2-84324] - Host: Rabbit. Target Name: Usp44. Sample Type: Rat Spleen lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

USP44 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit USP44 Antibody - BSA Free (NBP2-84324) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat USP44. Peptide sequence: PQKWFCMVCNTTESIWACLSCSHVACGQYIQEHALKHFEESSHPVAFEVN The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: USP44
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for USP44 Antibody - BSA Free

• Deubiquitinating enzyme 44
• DKFZp434D0127
• EC 3.1.2.15
• EC 3.4.19.12
• FLJ14528
• ubiquitin carboxyl-terminal hydrolase 44
• ubiquitin specific peptidase 44
• ubiquitin specific protease 44
• ubiquitin thioesterase 44
• Ubiquitin thiolesterase 44
• Ubiquitin-specific-processing protease 44
• USP44

Background

Modification of cellular proteins by ubiquitin is an essential regulatory mechanism controlled by the coordinated action of multiple ubiquitin-conjugating and deubiquitinating enzymes. USP44 belongs to a large family of cysteine proteases that function as deubiquitinating enzymes (Quesada et al., 2004 [PubMed 14715245]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: USP44