USP36 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: USP36 Antibody [NBP1-83709] - Staining of human cell line U-2 OS shows localization to nucleoli & nuclear speckles.
Immunohistochemistry-Paraffin: USP36 Antibody [NBP1-83709] - Staining of human liver shows strong nuclear positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

USP36 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DSLVHSSNVKVVLNQQAYVLFYLRIPGSKKSPEGLISRTGSSSLPGRPSVIPDHSKKNIGNGIISSPLTGKRQDSGTMKKPHTTEEIGVPISRNGSTLGLKSQNGCIPPKLPSGSPSPKLSQTPTHMPTILDDPGKKVKKPAPP
Marker
Nucleolus Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
USP36
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
USP36 Protein (NBP1-83709PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for USP36 Antibody

  • Deubiquitinating enzyme 36
  • DUB1
  • EC 3.1.2.15
  • EC 3.4.19.12
  • FLJ12851
  • KIAA1453deubiquitinating enzyme 1
  • ubiquitin carboxyl-terminal hydrolase 36
  • ubiquitin specific peptidase 36
  • ubiquitin specific protease 36
  • ubiquitin thioesterase 36
  • Ubiquitin thiolesterase 36
  • Ubiquitin-specific-processing protease 36

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6008
Species: Hu, Mu, Rt
Applications: WB
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF2988
Species: Mu, Rt
Applications: WB
NBP1-32083
Species: Hu
Applications: WB, ICC/IF
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
AF7735
Species: Hu
Applications: WB
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-15199
Species: Hu, Eq
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-85091
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19151
Species: Hu, Ma
Applications: WB, IHC-P, IP
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB300-269
Species: Hu, Mu, Rt, Ce, Ch, Dr, Pl, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
AF5650
Species: Hu
Applications: WB, IHC
NB110-40693
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-19842
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83709
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for USP36 Antibody (NBP1-83709) (0)

There are no publications for USP36 Antibody (NBP1-83709).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP36 Antibody (NBP1-83709) (0)

There are no reviews for USP36 Antibody (NBP1-83709). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for USP36 Antibody (NBP1-83709) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional USP36 Products

Bioinformatics Tool for USP36 Antibody (NBP1-83709)

Discover related pathways, diseases and genes to USP36 Antibody (NBP1-83709). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP36 Antibody (NBP1-83709)

Discover more about diseases related to USP36 Antibody (NBP1-83709).
 

Pathways for USP36 Antibody (NBP1-83709)

View related products by pathway.

PTMs for USP36 Antibody (NBP1-83709)

Learn more about PTMs related to USP36 Antibody (NBP1-83709).

Blogs on USP36

There are no specific blogs for USP36, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USP36 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol USP36