USP2 Antibody

Images

 
Western Blot: USP2 Antibody [NBP1-69153] - HCT15 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

USP2 Antibody Summary

Immunogen
Synthetic peptides corresponding to USP2 (ubiquitin specific peptidase 2) The peptide sequence was selected from the N terminal of USP2. Peptide sequence LLDYDRGRPLLRPDITGGGKRAESQTRGTERPLGSGLSGGSGFPYGVTNN.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
USP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against USP2 and was validated on Western blot.
Theoretical MW
68 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for USP2 Antibody

  • Deubiquitinating enzyme 2
  • EC 3.1.2.15
  • EC 3.4.19.12,41 kDa ubiquitin-specific protease
  • ubiquitin specific peptidase 2
  • ubiquitin specific protease 12
  • ubiquitin specific protease 2
  • ubiquitin specific protease 9
  • ubiquitin thioesterase 2
  • Ubiquitin thiolesterase 2
  • Ubiquitin-specific-processing protease 2
  • UBP41
  • UBP41ubiquitin carboxyl-terminal hydrolase 2
  • USP2
  • USP9

Background

Ubiquitin (MIM 191339), a highly conserved protein involved in the regulation of intracellular protein breakdown, cell cycle regulation, and stress response, is released from degraded proteins by disassembly of the polyubiquitin chains. The disassembly process is mediated by ubiquitin-specific proteases (USPs). Also see USP1 (MIM 603478).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6008
Species: Hu, Mu, Rt
Applications: WB
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-54974
Species: Hu
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-88117
Species: Hu
Applications: WB (-), WB, IHC, IHC-P, IP
NB600-1160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-48321
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP2-15141
Species: Hu
Applications: WB
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-69153
Species: Hu
Applications: WB

Publications for USP2 Antibody (NBP1-69153) (0)

There are no publications for USP2 Antibody (NBP1-69153).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP2 Antibody (NBP1-69153) (0)

There are no reviews for USP2 Antibody (NBP1-69153). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for USP2 Antibody (NBP1-69153) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional USP2 Products

Bioinformatics Tool for USP2 Antibody (NBP1-69153)

Discover related pathways, diseases and genes to USP2 Antibody (NBP1-69153). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP2 Antibody (NBP1-69153)

Discover more about diseases related to USP2 Antibody (NBP1-69153).
 

Pathways for USP2 Antibody (NBP1-69153)

View related products by pathway.

PTMs for USP2 Antibody (NBP1-69153)

Learn more about PTMs related to USP2 Antibody (NBP1-69153).

Blogs on USP2

There are no specific blogs for USP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol USP2
Entrez
Uniprot