USP14 Antibody (3A3J1)

Western Blot: USP14 Antibody (3A3J1) [NBP3-15796] - Western blot analysis of extracts of various cell lines, using USP14 Rabbit mAb (NBP3-15796) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunoprecipitation: USP14 Antibody (3A3J1) [NBP3-15796] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug USP14 antibody (NBP3-15796). Western blot was performed from the immunoprecipitate using USP14 antibody (NBP3-15796) at a dilition of 1:2000.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IP
• Clone: 3A3J1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

USP14 Antibody (3A3J1) Summary

• Description: Novus Biologicals Rabbit USP14 Antibody (3A3J1) (NBP3-15796) is a recombinant monoclonal antibody validated for use in WB and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 371-473 of human USP14 (P54578). RSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWH
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: USP14
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunoprecipitation 1:1000 - 1:5000
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for USP14 Antibody (3A3J1)

• Deubiquitinating enzyme 14
• EC 3.1.2.15
• EC 3.4.19.12
• TGT
• TGTubiquitin carboxyl-terminal hydrolase 14
• tRNA-guanine transglycosylase, 60-kD subunit
• ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase)
• ubiquitin specific protease 14 (tRNA-guanine transglycosylase)
• Ubiquitin Thioesterase 14
• Ubiquitin thiolesterase 14
• ubiquitin-specific processing protease 14
• Ubiquitin-specific-processing protease 14
• Ubp6
• USP14

Background

USP14 encodes a member of the ubiquitin-specific processing (UBP) family of proteases that is a deubiquitinating enzyme (DUB) with His and Cys domains. This protein is located in the cytoplasm and cleaves the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. Mice with a mutation that results in reduced expression of the ortholog of this protein are retarded for growth, develop severe tremors by 2 to 3 weeks of age followed by hindlimb paralysis and death by 6 to 10 weeks of age. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: USP14