![Immunohistochemistry-Paraffin: Uroplakin II Antibody [NBP2-33389] - Analysis in human urinary bladder and liver tissues. Corresponding UPK2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Uroplakin-II-Antibody-Immunohistochemistry-Paraffin-NBP2-33389-img0011.jpg "Immunohistochemistry-Paraffin: Uroplakin II Antibody [NBP2-33389] - Analysis in human urinary bladder and liver tissues. Corresponding UPK2 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit Uroplakin II Antibody - BSA Free (NBP2-33389) is a polyclonal antibody validated for use in IHC. Anti-Uroplakin II Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ISSLSGLLSPALTESLLVALPPCHLTGGNATLMVRRANDSKVVTSSFVVPPCRGRRELVS |
| Predicted Species | Mouse (95%), Rat (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | UPK2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
WB | Mouse | 02/04/2020 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Uroplakin II Antibody [NBP2-33389] - Staining of human cerebral cortex, colon, skeletal muscle and stomach using Anti-PGC antibody (A) NBP2-33389 shows similar protein distribution across tissues to independent antibody NBP2-38904 (B).](http://images.novusbio.com/fullsize/Uroplakin-II-Antibody-Immunohistochemistry-Paraffin-NBP2-33389-img0015.jpg "Immunohistochemistry-Paraffin: Uroplakin II Antibody [NBP2-33389] - Staining of human cerebral cortex, colon, skeletal muscle and stomach using Anti-PGC antibody (A) NBP2-33389 shows similar protein distribution across tissues to independent antibody NBP2-38904 (B).")
![Immunohistochemistry-Paraffin: Uroplakin II Antibody [NBP2-33389] - Staining of human urinary bladder shows high expression.](http://images.novusbio.com/fullsize/Uroplakin-II-Antibody-Immunohistochemistry-Paraffin-NBP2-33389-img0003.jpg "Immunohistochemistry-Paraffin: Uroplakin II Antibody [NBP2-33389] - Staining of human urinary bladder shows high expression.")
![Immunohistochemistry-Paraffin: Uroplakin II Antibody [NBP2-33389] - Staining of human cerebral cortex shows no positivity in neurons as expected.](http://images.novusbio.com/fullsize/Uroplakin-II-Antibody-Immunohistochemistry-Paraffin-NBP2-33389-img0012.jpg "Immunohistochemistry-Paraffin: Uroplakin II Antibody [NBP2-33389] - Staining of human cerebral cortex shows no positivity in neurons as expected.")
![Immunohistochemistry-Paraffin: Uroplakin II Antibody [NBP2-33389] - Staining of human endometrium shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/Uroplakin-II-Antibody-Immunohistochemistry-Paraffin-NBP2-33389-img0013.jpg "Immunohistochemistry-Paraffin: Uroplakin II Antibody [NBP2-33389] - Staining of human endometrium shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: Uroplakin II Antibody [NBP2-33389] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Uroplakin-II-Antibody-Immunohistochemistry-Paraffin-NBP2-33389-img0014.jpg "Immunohistochemistry-Paraffin: Uroplakin II Antibody [NBP2-33389] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![SDS-PAGE beta-NGF [Unconjugated]](https://images.novusbio.com/images2/beta-NGF_256-GF_321.jpg)
![Bioactivity beta-NGF [Unconjugated]](https://images.novusbio.com/images2/beta-NGF_256-GF_322.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
