Uroplakin Ib Antibody


Immunohistochemistry-Paraffin: Uroplakin Ib Antibody [NBP1-80657] - Staining of human urinary bladder shows high expression.
Immunohistochemistry-Paraffin: Uroplakin Ib Antibody [NBP1-80657] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: Uroplakin Ib Antibody [NBP1-80657] - Staining in human urinary bladder and liver tissues using anti-UPK1B antibody. Corresponding UPK1B RNA-seq data are presented for the same tissues.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P

Order Details

Uroplakin Ib Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: FTPNLFLKQMLERYQNNSPPNNDDQWKNNGVTKTWDRLMLQDNCCGVNGPSDW
Specificity of human Uroplakin Ib antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Uroplakin Ib Protein (NBP1-80657PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (87%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Uroplakin Ib Antibody

  • tetraspanin-20
  • TSPAN20
  • tspan-20
  • TSPAN20tetraspan
  • UP1b
  • UPIB
  • UPK1
  • UPK1B
  • Uroplakin 1B
  • Uroplakin Ib
  • uroplakin-1b


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: Flow, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, IF
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Ca
Applications: WB, DB, EM, ELISA, Flow, ICC/IF, IP, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Gt, Pm, Sh
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for Uroplakin Ib Antibody (NBP1-80657) (0)

There are no publications for Uroplakin Ib Antibody (NBP1-80657).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Uroplakin Ib Antibody (NBP1-80657) (0)

There are no reviews for Uroplakin Ib Antibody (NBP1-80657). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Uroplakin Ib Antibody (NBP1-80657) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Uroplakin Ib Products

Bioinformatics Tool for Uroplakin Ib Antibody (NBP1-80657)

Discover related pathways, diseases and genes to Uroplakin Ib Antibody (NBP1-80657). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Uroplakin Ib Antibody (NBP1-80657)

Discover more about diseases related to Uroplakin Ib Antibody (NBP1-80657).

Pathways for Uroplakin Ib Antibody (NBP1-80657)

View related products by pathway.

PTMs for Uroplakin Ib Antibody (NBP1-80657)

Learn more about PTMs related to Uroplakin Ib Antibody (NBP1-80657).

Blogs on Uroplakin Ib

There are no specific blogs for Uroplakin Ib, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Uroplakin Ib Antibody and receive a gift card or discount.


Gene Symbol UPK1B