Uroplakin Ib Antibody

Images

 
Immunohistochemistry-Paraffin: Uroplakin Ib Antibody [NBP1-80657] - Staining of human urinary bladder shows strong cytoplasmic and membranous positivity in urothelial cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Uroplakin Ib Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FTPNLFLKQMLERYQNNSPPNNDDQWKNNGVTKTWDRLMLQDNCCGVNGPSDW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UPK1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Uroplakin Ib Protein (NBP1-80657PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Uroplakin Ib Antibody

  • tetraspanin-20
  • TSPAN20
  • tspan-20
  • TSPAN20tetraspan
  • UP1b
  • UPIB
  • UPK1
  • UPK1B
  • Uroplakin 1B
  • Uroplakin Ib
  • uroplakin-1b

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38904
Species: Hu
Applications: Flow, IHC, IHC-P
NBP2-12482
Species: Hu
Applications: IHC, IHC-P
NBP2-14694
Species: Hu
Applications: IHC, IHC-P
NBP2-14694
Species: Hu
Applications: IHC, IHC-P
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-22187
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, IF
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-42225
Species: Hu, Ca
Applications: WB, DB, EM, ELISA, Flow, Func, ICC/IF, IP
NBP1-76775
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-65805
Species: Hu, Gt, Pm, Sh
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBL1-15012
Species: Hu
NBP1-88899
Species: Hu
Applications: IHC, IHC-P
MAB4624
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-86847
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-80657
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for Uroplakin Ib Antibody (NBP1-80657) (0)

There are no publications for Uroplakin Ib Antibody (NBP1-80657).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Uroplakin Ib Antibody (NBP1-80657) (0)

There are no reviews for Uroplakin Ib Antibody (NBP1-80657). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Uroplakin Ib Antibody (NBP1-80657) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Uroplakin Ib Products

Bioinformatics Tool for Uroplakin Ib Antibody (NBP1-80657)

Discover related pathways, diseases and genes to Uroplakin Ib Antibody (NBP1-80657). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Uroplakin Ib Antibody (NBP1-80657)

Discover more about diseases related to Uroplakin Ib Antibody (NBP1-80657).
 

Pathways for Uroplakin Ib Antibody (NBP1-80657)

View related products by pathway.

PTMs for Uroplakin Ib Antibody (NBP1-80657)

Learn more about PTMs related to Uroplakin Ib Antibody (NBP1-80657).

Blogs on Uroplakin Ib

There are no specific blogs for Uroplakin Ib, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Uroplakin Ib Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UPK1B
Entrez