![Immunohistochemistry-Paraffin: Uroplakin Ib Antibody [NBP1-80657] - Staining in human urinary bladder and liver tissues using NBP1-80657 antibody. Corresponding UPK1B RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Uroplakin-Ib-Antibody-Immunohistochemistry-Paraffin-NBP1-80657-img0013.jpg "Immunohistochemistry-Paraffin: Uroplakin Ib Antibody [NBP1-80657] - Staining in human urinary bladder and liver tissues using NBP1-80657 antibody. Corresponding UPK1B RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FTPNLFLKQMLERYQNNSPPNNDDQWKNNGVTKTWDRLMLQDNCCGVNGPSDW |
| Predicted Species | Mouse (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | UPK1B |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Uroplakin Ib Antibody (NBP1-80657)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Uroplakin Ib Antibody [NBP1-80657] - Staining of human cerebral cortex shows no positivity in neurons as expected.](http://images.novusbio.com/fullsize/Uroplakin-Ib-Antibody-Immunohistochemistry-Paraffin-NBP1-80657-img0009.jpg "Immunohistochemistry-Paraffin: Uroplakin Ib Antibody [NBP1-80657] - Staining of human cerebral cortex shows no positivity in neurons as expected.")
![Immunohistochemistry-Paraffin: Uroplakin Ib Antibody [NBP1-80657] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Uroplakin-Ib-Antibody-Immunohistochemistry-Paraffin-NBP1-80657-img0010.jpg "Immunohistochemistry-Paraffin: Uroplakin Ib Antibody [NBP1-80657] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: Uroplakin Ib Antibody [NBP1-80657] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/Uroplakin-Ib-Antibody-Immunohistochemistry-Paraffin-NBP1-80657-img0011.jpg "Immunohistochemistry-Paraffin: Uroplakin Ib Antibody [NBP1-80657] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: Uroplakin Ib Antibody [NBP1-80657] - Staining of human urinary bladder shows strong membranous positivity in urothelial cells.](http://images.novusbio.com/fullsize/Uroplakin-Ib-Antibody-Immunohistochemistry-Paraffin-NBP1-80657-img0012.jpg "Immunohistochemistry-Paraffin: Uroplakin Ib Antibody [NBP1-80657] - Staining of human urinary bladder shows strong membranous positivity in urothelial cells.")
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")