Novus Biologicals products are now on bio-techne.com

URB/CCD80 Antibody

Images

 
Western Blot: URB/CCD80 Antibody [NBP2-86044] - Host: Rabbit. Target Name: CCDC80. Sample Type: RPMI-8226 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

URB/CCD80 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human URB/CCD80. Peptide sequence: LRVKQYYEVPITMKSVFDLIDTFQSRIKDMEKQKKEGIVCKEDKKQSLEN The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC80
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for URB/CCD80 Antibody

  • CCDC80
  • coiled-coil domain containing 80
  • down-regulated by oncogenes protein 1
  • DRO1
  • SSG1
  • Steroid-sensitive protein 1
  • URB

Background

CCD80 is expressed in dermal papilla and dermal fibroblasts (at protein level) and in heart, thymus, placenta, pancreas, colon, epithelium, spleen and osteoblasts. There are three named isoforms produced by alternative splicing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB100-314
Species: Hu
Applications: IP, WB
NBP1-77086
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
AF7094
Species: Hu
Applications: IHC
NB100-2288
Species: Am, Hu, Mu, Pm, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
DCP00
Species: Hu
Applications: ELISA
DRP300
Species: Hu
Applications: ELISA
NBP1-88461
Species: Hu
Applications: IHC, IHC-P
NBP1-77370
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-24748
Species: Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-24859
Species: Ca, Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46005
Species: Hu, Mu, Rt
Applications: ICC/IF, IF, IHC, IHC-P, IP, PLA, WB
NB100-1519
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
NBP2-83997
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-86044
Species: Hu
Applications: WB

Publications for URB/CCD80 Antibody (NBP2-86044) (0)

There are no publications for URB/CCD80 Antibody (NBP2-86044).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for URB/CCD80 Antibody (NBP2-86044) (0)

There are no reviews for URB/CCD80 Antibody (NBP2-86044). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for URB/CCD80 Antibody (NBP2-86044) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our URB/CCD80 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC80