URB/CCD80 Antibody

Images

 
Western Blot: URB/CCD80 Antibody [NBP2-86044] - Host: Rabbit. Target Name: CCDC80. Sample Type: RPMI-8226 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

URB/CCD80 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human URB/CCD80. Peptide sequence: LRVKQYYEVPITMKSVFDLIDTFQSRIKDMEKQKKEGIVCKEDKKQSLEN The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC80
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for URB/CCD80 Antibody

  • CCDC80
  • coiled-coil domain containing 80
  • down-regulated by oncogenes protein 1
  • DRO1
  • SSG1
  • Steroid-sensitive protein 1
  • URB

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB100-314
Species: Hu
Applications: IP, WB
NBP1-77086
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-34260
Species: Bv, Hu, Mu, Po, Rb
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP2-37497
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB100-2288
Species: Hu, Mu, Pm, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
DCP00
Species: Hu
Applications: ELISA
DRP300
Species: Hu
Applications: ELISA
NBP1-33431
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-77370
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-24748
Species: Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-24859
Species: Ca, Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85296
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31329
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-83997
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-86044
Species: Hu
Applications: WB

Publications for URB/CCD80 Antibody (NBP2-86044) (0)

There are no publications for URB/CCD80 Antibody (NBP2-86044).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for URB/CCD80 Antibody (NBP2-86044) (0)

There are no reviews for URB/CCD80 Antibody (NBP2-86044). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for URB/CCD80 Antibody (NBP2-86044) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional URB/CCD80 Products

Bioinformatics Tool for URB/CCD80 Antibody (NBP2-86044)

Discover related pathways, diseases and genes to URB/CCD80 Antibody (NBP2-86044). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for URB/CCD80 Antibody (NBP2-86044)

Discover more about diseases related to URB/CCD80 Antibody (NBP2-86044).
 

Pathways for URB/CCD80 Antibody (NBP2-86044)

View related products by pathway.

Blogs on URB/CCD80

There are no specific blogs for URB/CCD80, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our URB/CCD80 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC80