UQCRQ Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: UQCRQ Antibody [NBP1-92563] - Immunofluorescent staining of human cell line MCF7 shows localization to mitochondria.
Immunohistochemistry-Paraffin: UQCRQ Antibody [NBP1-92563] - Staining of human gallbladder shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UQCRQ Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: REFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRR
Specificity
Specificity of human UQCRQ antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UQCRQ
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Publications
Read Publication using
NBP1-92563 in the following applications:

  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%). Human reactivity reported in scientific literature (PMID: 25605331).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UQCRQ Antibody

  • complex III subunit 8
  • cytochrome b-c1 complex subunit 8
  • low molecular mass ubiquinone-binding protein (9.5kD)
  • QPC
  • ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C
  • ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa
  • UQCR7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80860
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-56244
Species: Hu
Applications: WB, ICC/IF
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
NBP1-33427
Species: Hu
Applications: WB, ICC/IF, ChIP
NBP1-93442
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-80861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF-258-PB
Species: Hu
Applications: WB, Simple Western, IHC
NB110-74569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB300-232
Species: Hu, Mu, Rt, Po, Bv, Ch, Fe, Pa
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00010153-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-19533
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-62349
Species: Hu, Mu, Rt, Bv, Ca, GP, Rb
Applications: WB, ICC/IF, IHC
NBP1-82587
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84948
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41176
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
AF2905
Species: Hu
Applications: WB, ELISA, ICC
NBP1-86322
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49563
Species: Hu
Applications: WB, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-92563
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for UQCRQ Antibody (NBP1-92563)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for UQCRQ Antibody (NBP1-92563) (0)

There are no reviews for UQCRQ Antibody (NBP1-92563). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UQCRQ Antibody (NBP1-92563) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UQCRQ Products

Bioinformatics Tool for UQCRQ Antibody (NBP1-92563)

Discover related pathways, diseases and genes to UQCRQ Antibody (NBP1-92563). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UQCRQ Antibody (NBP1-92563)

Discover more about diseases related to UQCRQ Antibody (NBP1-92563).
 

Pathways for UQCRQ Antibody (NBP1-92563)

View related products by pathway.

Blogs on UQCRQ

There are no specific blogs for UQCRQ, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UQCRQ Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UQCRQ