UQCRB Antibody

Images

 
Western Blot: UQCRB Antibody [NBP1-80860] - Analysis in human cell line A-431.
Immunohistochemistry-Paraffin: UQCRB Antibody [NBP1-80860] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Western Blot: UQCRB Antibody [NBP1-80860] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UQCRB Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK
Specificity
Specificity of human, mouse, rat UQCRB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UQCRB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
WB reported in scientific literature (PMID: 25605331). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
UQCRB Protein (NBP1-80860PEP)
Publications
Read Publication using
NBP1-80860 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25605331).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UQCRB Antibody

  • Complex III subunit 7
  • Complex III subunit VII
  • cytochrome b-c1 complex subunit 7
  • QCR7
  • QPC
  • QP-CFLJ92016
  • ubiquinol-cytochrome c reductase binding protein
  • Ubiquinol-cytochrome c reductase complex 14 kDa protein
  • ubiquinol-cytochrome c reductase, complex III subunit VI
  • ubiquinone-binding protein
  • UQBC
  • UQBPFLJ97033
  • UQCR6
  • UQPC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92563
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47801
Species: Hu, Mu, Rt, Ca, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF-258-PB
Species: Hu
Applications: WB, Simple Western, IHC
AF855
Species: Mu
Applications: IHC
NBP2-15365
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81555
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45519
Species: Hu
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46376
Species: Hu
Applications: WB, IHC
NBP1-31037
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-19622
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12904
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-59438
Species: Hu
Applications: WB, ELISA, ICC/IF
AF2905
Species: Hu
Applications: WB, ELISA, ICC

Publications for UQCRB Antibody (NBP1-80860)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for UQCRB Antibody (NBP1-80860) (0)

There are no reviews for UQCRB Antibody (NBP1-80860). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UQCRB Antibody (NBP1-80860) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional UQCRB Products

Bioinformatics Tool for UQCRB Antibody (NBP1-80860)

Discover related pathways, diseases and genes to UQCRB Antibody (NBP1-80860). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UQCRB Antibody (NBP1-80860)

Discover more about diseases related to UQCRB Antibody (NBP1-80860).
 

Pathways for UQCRB Antibody (NBP1-80860)

View related products by pathway.

PTMs for UQCRB Antibody (NBP1-80860)

Learn more about PTMs related to UQCRB Antibody (NBP1-80860).

Blogs on UQCRB

There are no specific blogs for UQCRB, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UQCRB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UQCRB
Entrez