| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit UQCRB Antibody - BSA Free (NBP1-80860) is a polyclonal antibody validated for use in IHC and WB. Anti-UQCRB Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | UQCRB |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | WB reported in scientific literature (PMID: 25605331). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publications using NBP1-80860 | Applications | Species |
|---|---|---|
| Nawfal Al-hashimi Investigating the Effect of the Amelogenin Peptide C11 on Differentiation of Stem Cells of the Apical Papilla (SCAP) toward an Odontoblastic Phenotype: A Pilot Study in Regenerative Endodontics Thesis 2022-01-01 (IHC-P, Human) | IHC-P | Human |
| Martin S, Mu D CRISPR-Induced Loss of Connexin 43 Expression Sensitizes KRAS Mutant Cells to Cisplatin microPublication biology 2022-11-13 [PMID: 36447529] (WB, Human) | WB | Human |
| Desmurs M, Foti M, Raemy E et al. C11orf83, a Mitochondrial Cardiolipin-Binding Protein Involved in bc1 Complex Assembly and Supercomplex Stabilization. Mol Cell Biol 2015-04-01 [PMID: 25605331] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for UQCRB Antibody (NBP1-80860)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.