UQCRFS1 Antibody - BSA Free

Western Blot: UQCRFS1 Antibody [NBP2-38623] - Analysis using Anti-UQCRFS1 antibody NBP2-38623 (A) shows similar pattern to independent antibody NBP1-87826 (B).

Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP2-38623] - Staining of human colon.

Western Blot: UQCRFS1 Antibody [NBP2-38623] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunohistochemistry: UQCRFS1 Antibody [NBP2-38623] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP2-38623] - Staining of human colon, kidney, liver and testis using Anti-UQCRFS1 antibody NBP2-38623 (A) shows similar protein distribution across tissues to independent antibody NBP1-87826 (B).

Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP2-38623] - Staining of human liver.

Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP2-38623] - Staining of human kidney.

Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP2-38623] - Staining of human testis.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

UQCRFS1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit UQCRFS1 Antibody - BSA Free (NBP2-38623) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VTQFVSSMSASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQHDL
• Predicted Species: Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UQCRFS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  UQCRFS1 Protein (NBP2-38623PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for UQCRFS1 Antibody - BSA Free

• Complex III subunit 5
• Cytochrome b-c1 complex subunit 5
• cytochrome b-c1 complex subunit Rieske, mitochondrial
• EC 1.10.2.2
• Rieske iron-sulfur protein
• RIP1
• RIS1
• RISPUbiquinol-cytochrome c reductase iron-sulfur subunit
• ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1
• UQCR5

Background

RIP1 is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis Function: The transit peptide of the Rieske protein seems

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UQCRFS1
• Uniprot:
  • P47985(Human)