UQCRC2 Antibody - BSA Free

Immunoprecipitation: UQCRC2 Antibody [NBP3-38078] - Immunoprecipitation analysis of 200 ug extracts of HepG2 cells using UQCRC2 antibody. Western blot was performed from the immunoprecipitate using UQCRC2 antibody at a dilution of 1:1000.

Immunohistochemistry: UQCRC2 Antibody [NBP3-38078] - Immunohistochemistry analysis of paraffin-embedded Human colon using UQCRC2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Western Blot: UQCRC2 Antibody [NBP3-38078] - Western blot analysis of various lysates using UQCRC2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.

Immunohistochemistry: UQCRC2 Antibody [NBP3-38078] - Immunohistochemistry analysis of paraffin-embedded Rat kidney using UQCRC2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

UQCRC2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit UQCRC2 Antibody - BSA Free (NBP3-38078) is a polyclonal antibody validated for use in IHC, WB, ELISA and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 224-453 of human UQCRC2 (NP_003357.2).
  
  Sequence:
  GVSHPVLKQVAEQFLNMRGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQIDSVANADIINAAKKFVSGQKSMAASGNLGHTPFVDEL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UQCRC2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 48 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for UQCRC2 Antibody - BSA Free

• Complex III subunit 2
• Core protein II
• cytochrome b-c1 complex subunit 2, mitochondrial
• QCR2
• ubiquinol-cytochrome c reductase core protein II
• Ubiquinol-cytochrome-c reductase complex core protein 2
• UQCR2

Background

This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex),which is part of the mitochondrial respiratory chain. The core protein 2 is required for the assembly of the complex

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UQCRC2