| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit UQCRC2 Antibody - BSA Free (NBP1-80862) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-UQCRC2 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEELHYFVQN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | UQCRC2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publications using NBP1-80862 | Applications | Species |
|---|---|---|
| Kim JS, Lee HL, Jeong JH et al. OR2AT4, an Ectopic Olfactory Receptor, Suppresses Oxidative Stress-Induced Senescence in Human Keratinocytes Antioxidants (Basel, Switzerland) 2022-11-03 [PMID: 36358552] (WB, Human) Details: Dilution used in ICC 1:200 |
WB | Human |
| Das S, Parray H, Chiranjivi A et al. Kennedy epitope (KE)-dependent retrograde transport of efficiently cleaved HIV-1 envelopes (Envs) and its effect on Env cell surface expression and viral particle formation Research Square 2022-11-10 (WB, Human) | WB | Human |
| Lai D, Tan CL, Gunaratne J et al. Localization of HPV-18 E2 at Mitochondrial Membranes Induces ROS Release and Modulates Host Cell Metabolism. PLoS One 2013-01-01 [PMID: 24086592] |
Secondary Antibodies |
Isotype Controls |
Research Areas for UQCRC2 Antibody (NBP1-80862)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.