UQCRC2 Antibody - BSA Free

Western Blot: UQCRC2 Antibody [NBP1-80862] - Analysis using Anti-UQCRC2 antibody NBP1-80862 (A) shows similar pattern to independent antibody NBP1-80861 (B).

Immunocytochemistry/Immunofluorescence: UQCRC2 Antibody [NBP1-80862] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.

Immunohistochemistry-Paraffin: UQCRC2 Antibody [NBP1-80862] - Staining of human liver.

Immunohistochemistry-Paraffin: UQCRC2 Antibody [NBP1-80862] - Staining of human kidney shows distinct cytoplasmic positivity with granular pattern in tubule cells.

Immunohistochemistry-Paraffin: UQCRC2 Antibody [NBP1-80862] - Staining of human heart muscle shows high expression.

Immunohistochemistry-Paraffin: UQCRC2 Antibody [NBP1-80862] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: UQCRC2 Antibody [NBP1-80862] - Staining in human heart muscle and pancreas tissues using anti-UQCRC2 antibody. Corresponding UQCRC2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: UQCRC2 Antibody [NBP1-80862] - Staining of human cerebral cortex, heart muscle, liver and pancreas using Anti-UQCRC2 antibody NBP1-80862 (A) shows similar protein distribution across tissues to independent antibody NBP1-80861 (B).

Immunohistochemistry-Paraffin: UQCRC2 Antibody [NBP1-80862] - Staining of human cerebral cortex.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

UQCRC2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit UQCRC2 Antibody - BSA Free (NBP1-80862) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-UQCRC2 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEELHYFVQN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UQCRC2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  UQCRC2 Protein (NBP1-80862PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (85%). Reactivity reported in scientific literature (PMID: 24086592)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for UQCRC2 Antibody - BSA Free

• Complex III subunit 2
• Core protein II
• cytochrome b-c1 complex subunit 2, mitochondrial
• QCR2
• ubiquinol-cytochrome c reductase core protein II
• Ubiquinol-cytochrome-c reductase complex core protein 2
• UQCR2

Background

This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex),which is part of the mitochondrial respiratory chain. The core protein 2 is required for the assembly of the complex

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for UQCRC2 Antibody (NBP1-80862)(3)

Publications using NBP1-80862

• Kim JS, Lee HL, Jeong JH et al. OR2AT4, an Ectopic Olfactory Receptor, Suppresses Oxidative Stress-Induced Senescence in Human Keratinocytes Antioxidants (Basel, Switzerland) 2022-11-03 [PMID: 36358552] (WB, Human)
  
  Details:
  Dilution used in ICC 1:200
• Das S, Parray H, Chiranjivi A et al. Kennedy epitope (KE)-dependent retrograde transport of efficiently cleaved HIV-1 envelopes (Envs) and its effect on Env cell surface expression and viral particle formation Research Square 2022-11-10 (WB, Human)
• Lai D, Tan CL, Gunaratne J et al. Localization of HPV-18 E2 at Mitochondrial Membranes Induces ROS Release and Modulates Host Cell Metabolism. PLoS One 2013-01-01 [PMID: 24086592]

Bioinformatics

• Gene Symbol: UQCRC2
• Entrez:
  • 7385(Human)
• Uniprot:
  • P22695(Human)