UPF2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: UPF2 Antibody [NBP2-57706] - Staining of human cell line HaCaT shows localization to cytosol & cytoplasmic bodies.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UPF2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LTRKGNKQQFKILNVPMSSQLAANHWNQQQAEQEERMRMKKLTLDINERQEQEDYQEMLQSLAQRPAPANTNRERRPRYQHPKGAPNADLIFKTGG
Specificity
Specificity of human UPF2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UPF2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
UPF2 Recombinant Protein Antigen (NBP2-57706PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for UPF2 Antibody

  • DKFZP434D222
  • HUPF2
  • KIAA1408MGC138835
  • Nonsense mRNA reducing factor 2
  • regulator of nonsense transcripts 2
  • RENT2MGC138834
  • smg-3
  • UPF2 regulator of nonsense transcripts homolog (yeast)
  • Up-frameshift suppressor 2 homolog
  • yeast Upf2p homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-368
Species: Hu, Mu
Applications: WB
H00065110-M06
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-82024
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-83134
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88376
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-80532
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-71662
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-41313
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-69312
Species: Hu
Applications: WB, IHC, IHC-P
H00023049-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
H00055110-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-92410
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31113
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
H00004116-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-33897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57706
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for UPF2 Antibody (NBP2-57706) (0)

There are no publications for UPF2 Antibody (NBP2-57706).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UPF2 Antibody (NBP2-57706) (0)

There are no reviews for UPF2 Antibody (NBP2-57706). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for UPF2 Antibody (NBP2-57706) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional UPF2 Products

Array NBP2-57706

Bioinformatics Tool for UPF2 Antibody (NBP2-57706)

Discover related pathways, diseases and genes to UPF2 Antibody (NBP2-57706). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UPF2 Antibody (NBP2-57706)

Discover more about diseases related to UPF2 Antibody (NBP2-57706).
 

Pathways for UPF2 Antibody (NBP2-57706)

View related products by pathway.

PTMs for UPF2 Antibody (NBP2-57706)

Learn more about PTMs related to UPF2 Antibody (NBP2-57706).

Blogs on UPF2

There are no specific blogs for UPF2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UPF2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UPF2