We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human UNC13D/Munc 13-4 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related UNC13D/Munc 13-4 Peptides and Proteins

Order Details


    • Catalog Number
      H00201294-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human UNC13D/Munc 13-4 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 2-100 of Human UNC13D/Munc 13-4

Source: Wheat Germ (in vitro)

Amino Acid Sequence: ATLLSHPQQRPPFLRQAIKIRRRRVRDLQDPPPQMAPEIQPPSHHFSPEQRALLYEDALYTVLHRLGHPEPNHVTEASELLRYLQEAFHVEPEEHQQTL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
UNC13D
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human UNC13D/Munc 13-4 GST (N-Term) Protein

  • FHL3
  • HLH3
  • HPLH3
  • Munc13-4
  • Munc13-4protein unc-13 homolog D
  • unc-13 homolog D (C. elegans)
  • UNC13D

Background

This gene encodes a protein that is a member of the UNC13 family, containing similar domain structure as other family members but lacking an N-terminal phorbol ester-binding C1 domain present in other Munc13 proteins. The protein appears to play a role in vesicle maturation during exocytosis and is involved in regulation of cytolytic granules secretion. Mutations in this gene are associated with familial hemophagocytic lymphohistiocytosis type 3, a genetically heterogeneous, rare autosomal recessive disorder. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86122
Species: Hu
Applications: IHC,  IHC-P, WB
H00005873-M02
Species: Hu, Mu, Rb
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, KD, S-ELISA, WB
NBP3-17459
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF5900
Species: Hu
Applications: WB
NBP1-84978
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-33037
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-32660
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB120-19294
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00001130-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
MAB5938
Species: Hu
Applications: ICC, WB
NBP1-84843
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
202-IL
Species: Hu
Applications: BA
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NBP1-84764
Species: Hu
Applications: IHC,  IHC-P
AF8221
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
H00201294-Q01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for UNC13D/Munc 13-4 Partial Recombinant Protein (H00201294-Q01) (0)

There are no publications for UNC13D/Munc 13-4 Partial Recombinant Protein (H00201294-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UNC13D/Munc 13-4 Partial Recombinant Protein (H00201294-Q01) (0)

There are no reviews for UNC13D/Munc 13-4 Partial Recombinant Protein (H00201294-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UNC13D/Munc 13-4 Partial Recombinant Protein (H00201294-Q01). (Showing 1 - 1 of 1 FAQ).

  1. I'm looking Munc13-4 N terminal antibody with related epitope sequence.
    • Unfortunately we do not epitope map our antibodies, but we do have a whole list of antibodies against your target depending on species reactivity and application you want to use them for. Please see this link to our MUNC 13-4 antibodies. All of the immunogen information that is not proprietary, or known should be presented on the datasheet. Often times a range will be provided where the peptide falls within, or if it was raised against a larger recombinant protein as is the case for the one you inquired about we do not know exactly where the binding occurs.

Additional UNC13D/Munc 13-4 Products

Blogs on UNC13D/Munc 13-4

There are no specific blogs for UNC13D/Munc 13-4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human UNC13D/Munc 13-4 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol UNC13D