ULBP-1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

ULBP-1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ULBP-1.

  Source: E. coli

  Amino Acid Sequence: WTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPGTTQPK

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: ULBP1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58022.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ULBP-1 Recombinant Protein Antigen

• ALCAN-beta
• MULT-1
• N2DL1
• N2DL-1
• NKG2D ligand 1
• NKG2DL
• NKG2DL1
• RAET1I
• RAET1Ialcan-beta
• Retinoic acid early transcript 1I
• UL16 binding protein 1
• UL16-binding protein 1
• ULBP1
• ULBP-1

Background

Ligand for the NKG2D receptor, together with at least ULBP2 and ULBP3. ULBPs activate multiple signalingpathways in primary NK cells, resulting in the production of cytokines and chemokines. Binding of ULBPs ligands toNKG2D induces calcium mobilization and activation of the JAK2, STAT5, ERK and PI3K kinase/Akt signal transductionpathway. In CMV infected cells, interacts with soluble CMV glycoprotein UL16. The interaction with UL16 blocked theinteraction with the NKG2D receptor, providing a mechanism by which CMV infected cells might escape the immune system.UL16 also causes ULBP1 to be retained in the ER and cis-Golgi apparatus so that it does not reach the cell surface

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: ULBP1