UGT1A6 Antibody

Images

 
Western Blot: UGT1A6 Antibody [NBP1-69707] - This Anti-UGT1A6 antibody was used in Western Blot of 293T tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry: UGT1A6 Antibody [NBP1-69707] - Human Liver Tissue Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1 : 100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UGT1A6 Antibody Summary

Immunogen
Synthetic peptides corresponding to UGT1A6(UDP glucuronosyltransferase 1 family, polypeptide A6) The peptide sequence was selected from the C terminal of UGT1A6 (NP_001063). Peptide sequence APHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGK.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UGT1A6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against UGT1A6 and was validated on Western blot.
Theoretical MW
61 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for UGT1A6 Antibody

  • GNT1UDPGT 1-6
  • HLUGP
  • HLUGP1
  • MGC29860
  • Phenol-metabolizing UDP-glucuronosyltransferase
  • UDP glucuronosyltransferase 1 family, polypeptide A6
  • UDP glycosyltransferase 1 family, polypeptide A6
  • UDP-glucuronosyltransferase 1 family polypeptide A6s
  • UDP-glucuronosyltransferase 1-6
  • UDP-glucuronosyltransferase 1A6
  • UDP-glucuronosyltransferase 1-F
  • UDPGT
  • UGT1
  • UGT1*6
  • UGT1.6
  • UGT1-06
  • UGT1A6S
  • UGT-1F
  • UGT1FEC 2.4.1.17

Background

UGT1A6 is a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme is active on phenolic and planar compounds. Alternative splicing in the unique 5' end of this gene results in two transcript variants.This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene is active on phenolic and planar compounds. Alternative splicing in the unique 5' end of this gene results in two transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6490
Species: Hu
Applications: WB, IHC, ICC
H00054600-B01P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
H00007364-M02-100ug
Species: Hu, Rt
Applications: WB, ELISA
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-69412
Species: Hu
Applications: WB
NBP1-91335
Species: Hu
Applications: WB, ICC/IF, IHC
H00054659-M02
Species: Hu
Applications: WB, ELISA
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-06724
Species: Hu
H00007366-B01P
Species: Hu
Applications: WB
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB200-209
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC

Publications for UGT1A6 Antibody (NBP1-69707) (0)

There are no publications for UGT1A6 Antibody (NBP1-69707).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UGT1A6 Antibody (NBP1-69707) (0)

There are no reviews for UGT1A6 Antibody (NBP1-69707). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UGT1A6 Antibody (NBP1-69707) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UGT1A6 Products

Bioinformatics Tool for UGT1A6 Antibody (NBP1-69707)

Discover related pathways, diseases and genes to UGT1A6 Antibody (NBP1-69707). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UGT1A6 Antibody (NBP1-69707)

Discover more about diseases related to UGT1A6 Antibody (NBP1-69707).
 

Pathways for UGT1A6 Antibody (NBP1-69707)

View related products by pathway.

PTMs for UGT1A6 Antibody (NBP1-69707)

Learn more about PTMs related to UGT1A6 Antibody (NBP1-69707).
 

Research Areas for UGT1A6 Antibody (NBP1-69707)

Find related products by research area.

Blogs on UGT1A6

There are no specific blogs for UGT1A6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UGT1A6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UGT1A6
Entrez
Uniprot