UGP2 Antibody - BSA Free

Western Blot: UGP2 Antibody [NBP2-48625] - Analysis using Anti-UGP2 antibody NBP2-48625 (A) shows similar pattern to independent antibody NBP1-85918 (B).

Immunohistochemistry: UGP2 Antibody [NBP2-48625] - Staining of human liver shows strong cytoplasmic and membranous positivity in hepatocytes and bile duct cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

UGP2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSY
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UGP2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  UGP2 Recombinant Protein Antigen (NBP2-48625PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for UGP2 Antibody - BSA Free

• EC 2.7.7.9
• pHC379
• UDPG
• UDP-glucose diphosphorylase
• UDP-glucose pyrophosphorylase 2
• UDP-glucose pyrophosphorylase
• UDPGP
• UDPGP2
• UGP1
• UGPase 2
• UGPase
• UGPP2
• uridyl diphosphate glucose pyrophosphorylase 2
• UTP-glucose-1-phosphate uridyltransferase
• UTP--glucose-1-phosphate uridylyltransferase 2
• UTP--glucose-1-phosphate uridylyltransferase

Background

The enzyme encoded by this gene is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen; in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. The eukaryotic enzyme has no significant sequence similarity to the prokaryotic enzyme. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UGP2