UGP2 Antibody


Western Blot: UGP2 Antibody [NBP1-85918] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate
Immunohistochemistry-Paraffin: UGP2 Antibody [NBP1-85918] - Staining of human liver shows cytoplasmic and membranous positivity in hepatocytes.
Western Blot: UGP2 Antibody [NBP1-85918] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane more

Product Details

Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

UGP2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:TVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNL
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
UGP2 Protein (NBP1-85918PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for UGP2 Antibody

  • EC
  • pHC379
  • UDPG
  • UDP-glucose diphosphorylase
  • UDP-glucose pyrophosphorylase 2
  • UDP-glucose pyrophosphorylase
  • UDPGP2
  • UGP1
  • UGPase 2
  • UGPase
  • UGPP2
  • uridyl diphosphate glucose pyrophosphorylase 2
  • UTP-glucose-1-phosphate uridyltransferase
  • UTP--glucose-1-phosphate uridylyltransferase 2
  • UTP--glucose-1-phosphate uridylyltransferase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Simple Western
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq, Ha, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA

Publications for UGP2 Antibody (NBP1-85918) (0)

There are no publications for UGP2 Antibody (NBP1-85918).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UGP2 Antibody (NBP1-85918) (0)

There are no reviews for UGP2 Antibody (NBP1-85918). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UGP2 Antibody (NBP1-85918) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional UGP2 Products

Bioinformatics Tool for UGP2 Antibody (NBP1-85918)

Discover related pathways, diseases and genes to UGP2 Antibody (NBP1-85918). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UGP2 Antibody (NBP1-85918)

Discover more about diseases related to UGP2 Antibody (NBP1-85918).

Pathways for UGP2 Antibody (NBP1-85918)

View related products by pathway.

Research Areas for UGP2 Antibody (NBP1-85918)

Find related products by research area.

Blogs on UGP2

There are no specific blogs for UGP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our UGP2 Antibody and receive a gift card or discount.


Gene Symbol UGP2