UFM1 Antibody

Images

 
Western Blot: UFM1 Antibody [NBP1-88977] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: U-87 MG
Immunohistochemistry: UFM1 Antibody [NBP1-88977] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UFM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IRAFPTTTPRSLHLFTSSTFLARALPGAFPTGACEERLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGSC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UFM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
UFM1 Protein (NBP1-88977PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UFM1 Antibody

  • bA131P10.1
  • BM-002
  • C13orf20
  • chromosome 13 open reading frame 20
  • ubiquitin-fold modifier 1
  • UFM1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82087
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81676
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86781
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80643
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88308
Species: Hu
Applications: IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-90692
Species: Hu
Applications: WB, IHC, IHC-P, KO
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP2-37523
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-86780
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-55035
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for UFM1 Antibody (NBP1-88977) (0)

There are no publications for UFM1 Antibody (NBP1-88977).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UFM1 Antibody (NBP1-88977) (0)

There are no reviews for UFM1 Antibody (NBP1-88977). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UFM1 Antibody (NBP1-88977) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UFM1 Products

Bioinformatics Tool for UFM1 Antibody (NBP1-88977)

Discover related pathways, diseases and genes to UFM1 Antibody (NBP1-88977). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UFM1 Antibody (NBP1-88977)

Discover more about diseases related to UFM1 Antibody (NBP1-88977).
 

Pathways for UFM1 Antibody (NBP1-88977)

View related products by pathway.

PTMs for UFM1 Antibody (NBP1-88977)

Learn more about PTMs related to UFM1 Antibody (NBP1-88977).

Blogs on UFM1

There are no specific blogs for UFM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UFM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UFM1
Entrez