UFSP2 Antibody


Western Blot: UFSP2 Antibody [NBP1-86781] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: UFSP2 Antibody [NBP1-86781] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: UFSP2 Antibody [NBP1-86781] - Staining of human thyroid gland shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

UFSP2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LAFQLATPNEIFLKKALKHVLSDLSTKLSSNALVFRICHSSVYIWPSSDINTIPGELTDASACKNILRFIQFEPEED
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
UFSP2 Protein (NBP1-86781PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for UFSP2 Antibody

  • FLJ11200
  • UFM1-specific peptidase 2
  • ufm1-specific protease 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, IHC, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB
Species: Ca, Hu, Mu
Applications: BA, B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB

Publications for UFSP2 Antibody (NBP1-86781) (0)

There are no publications for UFSP2 Antibody (NBP1-86781).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UFSP2 Antibody (NBP1-86781) (0)

There are no reviews for UFSP2 Antibody (NBP1-86781). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UFSP2 Antibody (NBP1-86781) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional UFSP2 Products

Array NBP1-86781

Bioinformatics Tool for UFSP2 Antibody (NBP1-86781)

Discover related pathways, diseases and genes to UFSP2 Antibody (NBP1-86781). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UFSP2 Antibody (NBP1-86781)

Discover more about diseases related to UFSP2 Antibody (NBP1-86781).

Pathways for UFSP2 Antibody (NBP1-86781)

View related products by pathway.

PTMs for UFSP2 Antibody (NBP1-86781)

Learn more about PTMs related to UFSP2 Antibody (NBP1-86781).

Blogs on UFSP2

There are no specific blogs for UFSP2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our UFSP2 Antibody and receive a gift card or discount.


Gene Symbol UFSP2