UFSP2 Antibody

Images

 
Western Blot: UFSP2 Antibody [NBP1-86781] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: UFSP2 Antibody [NBP1-86781] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: UFSP2 Antibody [NBP1-86781] - Staining of human thyroid gland shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UFSP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LAFQLATPNEIFLKKALKHVLSDLSTKLSSNALVFRICHSSVYIWPSSDINTIPGELTDASACKNILRFIQFEPEED
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UFSP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
UFSP2 Protein (NBP1-86781PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UFSP2 Antibody

  • FLJ11200
  • UFM1-specific peptidase 2
  • ufm1-specific protease 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF8237
Species: Hu
Applications: WB, ICC
NBP1-80643
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP2-24709
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88308
Species: Hu
Applications: IHC, IHC-P
NBP1-85361
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87424
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82085
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00918
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P
AF877
Species: Hu
Applications: WB, IHC, IP
NBP1-83579
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB3446
Species: Hu
Applications: WB
NBP1-82819
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC

Publications for UFSP2 Antibody (NBP1-86781) (0)

There are no publications for UFSP2 Antibody (NBP1-86781).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UFSP2 Antibody (NBP1-86781) (0)

There are no reviews for UFSP2 Antibody (NBP1-86781). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UFSP2 Antibody (NBP1-86781) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UFSP2 Products

UFSP2 NBP1-86781

Bioinformatics Tool for UFSP2 Antibody (NBP1-86781)

Discover related pathways, diseases and genes to UFSP2 Antibody (NBP1-86781). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UFSP2 Antibody (NBP1-86781)

Discover more about diseases related to UFSP2 Antibody (NBP1-86781).
 

Pathways for UFSP2 Antibody (NBP1-86781)

View related products by pathway.

PTMs for UFSP2 Antibody (NBP1-86781)

Learn more about PTMs related to UFSP2 Antibody (NBP1-86781).

Blogs on UFSP2

There are no specific blogs for UFSP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UFSP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UFSP2